KEGG   Mus musculus (mouse): 226418
Entry
226418            CDS       T01002                                 

Gene name
Yod1, 6330564D18Rik, 9930028C20Rik, Hshin7
Definition
(RefSeq) YOD1 deubiquitinase
  KO
K13719  ubiquitin thioesterase OTU1 [EC:3.1.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    226418 (Yod1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    226418 (Yod1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     226418 (Yod1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C88
   226418 (Yod1)
SSDB
Motif
Pfam: OTU Ubiquitin_2 zf-C2H2_2
Other DBs
NCBI-GeneID: 226418
NCBI-ProteinID: NP_848806
MGI: 2442596
Ensembl: ENSMUSG00000046404
Vega: OTTMUSG00000049609
UniProt: Q8CB27
Structure
PDB: 
2KZR

Position
1; 1 E4
AA seq 343 aa
MFGGAKGGHFGVPPAGYSGAVPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSS
RTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQT
RPKASPAFSKYGAPSYVREALPVLTRTAVPADNSCLFTSVYYVVEGGVLNPACAPEMRRL
IAQIVASDPVLYSEAILGKTNEDYCDWIRRDDTWGGAIEISILSKFYQCEICVVDTQTVR
IDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEAR
RKRQFTDVNRFTLRCMICQKGLTGQAEARDHARETGHTNFGEV
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgtttggaggcgccaaaggcggccattttggggtcccccccgctggttactccggcgct
gtcccccagtctgaggctgggaccaaggctggccccgcaggaggccggccggccgacact
atgtggcgggtccgctgcaaggccaagggtggcacccaccttttgcagggtctttccagc
cggacccgcttacgggagctgcagggccaaatcgccgctatcaccggcatcgctcccggc
agtcagcgaatcctcgttggctacccgcccgagtgcctggatctcagcgaccgggacatc
actcttggggacctgcccatccagtcaggtgacatgctgattgttgaagaagaccaaacc
agaccaaaagcttcacctgcgttttcaaaatatggtgctcctagttatgtcagggaagct
ctgcctgtgcttaccagaaccgcagtcccagcagacaactcttgcctctttaccagtgtg
tactatgtcgtggaaggaggagtcttgaatccagcttgtgcccctgagatgagacgcctc
atagcacaaattgtagcaagtgatccagtcttgtatagtgaggcgatactgggaaagaca
aacgaagactactgtgattggatcagaagggatgatacgtgggggggggcaatcgagatc
tcaatcctgtctaagttttaccaatgtgaaatatgtgtagtagatacacagacagtcaga
attgatcgttttggggaagatgcaggatataccaaaagagttctgcttatctacgatggc
attcactacgatccgcttcagcgtaacttccctgatccagatacccctcctctgaccatt
ttctcctcaaatgatgatattgttcttgtacaagcactggaattagctgatgaagctaga
agaaagagacagttcactgatgtaaaccgcttcaccctgagatgcatgatctgtcagaag
ggcctaaccggacaagcagaagcaagggaccatgccagggagacaggccataccaacttt
ggagaggtgtga

DBGET integrated database retrieval system