KEGG   Mus musculus (house mouse): 226422
Entry
226422            CDS       T01002                                 
Symbol
Rab29, Rab7l1
Name
(RefSeq) RAB29, member RAS oncogene family
  KO
K07916  Ras-related protein Rab-7L1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    226422 (Rab29)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    226422 (Rab29)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA PduV-EutP DLIC AAA_16 TniB AAA_7 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 226422
NCBI-ProteinID: NP_659124
MGI: 2385107
Ensembl: ENSMUSG00000026433
UniProt: E9QLQ7
Position
1:131794948..131800625
AA seq 204 aa
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQ
LWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPC
LLLANKSDLSPWAVSRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSRED
VMSLSTQGNYINLQAKPSSGWTCC
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcagccgagatcacctgtttaaagtgctggtggtgggggacgccgccgttggcaag
acgtctctggtccagcgctactcccaggacagcttcagcaagcactacaagtccaccgtg
ggagtggattttgctctcaaggttctccagtggtctgactcagagatggtgcggctgcag
ctctgggatattgcagggcaggagcgtttcacatccatgacacgactctactatagagat
gcttctgcctgtgttattatgtttgacgtcaccaatgccactactttcagcaacagccaa
agatggaaacaggatctggacagcaagctcacactacccagtggggagccagtgccctgc
ctgctcttggccaacaagagtgatctgtccccttgggcagtgagccgggaccagatcgac
cagttcagtaaagagaatggcttcacaggttggacagaaacatcagtcaaggagaacaaa
aatattaatgaggccatgagagtcctcgttgaaaagatgatgaacaattccagggaagat
gtgatgtctttgtccacccaagggaactacatcaatctccaagccaagccctcctctggc
tggacatgctgctag

DBGET integrated database retrieval system