KEGG   Mus musculus (house mouse): 226438
Entry
226438            CDS       T01002                                 
Symbol
Igfn1, 9830123M21Rik
Name
(RefSeq) immunoglobulin-like and fibronectin type III domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 THB V-set Tissue_fac C2-set_2
Other DBs
NCBI-GeneID: 226438
NCBI-ProteinID: NP_808310
MGI: 3045352
Ensembl: ENSMUSG00000051985
UniProt: Q3KNY0
Position
1:complement(135880943..135968663)
AA seq 2849 aa
MNEMRTQVRIEFHALATQRKPSASPPTIEEDMGQGCTLEALVIPSRRAEQSTQHPDSSFM
ATVRGAKSVVVSQWQLLQAGSAGSAARPDGSGSESLAASSSWKPRRRLEAGGPCRSWLVF
LVSREGWSDSNPGYRKQFICRPQEIGFHSEEHREAGTMAAKPPKKSSIPGVSIRQLVDEI
PEGCSTPDFKQKPVTLALPEGKNAIFRAVVCGEPRPEVHWQSSKGDLSNSAKYQISSAPG
REEHVLQINKLTGEDSDLYRCTALNAYGEATCSVRLTVIEVGFRKNRKRQKEPQEDLRKE
LMDFRKMLKKRAPPPTPEKKMESEQVWQLLVTADRKDYEKICMQYGIVDFRGMLRKLQEM
KKEQEDRMAQYVSAIANLRHIKVTKEGVATFDLELDLKNLESKIYLYKDGEMIPYGVDNQ
TKHCLRRLGKRYHFQIQDLRPEDAGLYQVMVEDAVVFSTELESRTIPPRVVVPLAETRCE
ERGDAVFECTLSNPCPSATWHFQHRPLRLSDKYEVFVSPDGLTHRLVVKGASSSDMGLYS
LNTGLHASSAWLVVEGGKDKGPQTTDTDHRLQTPEALASEAEDAGGISIKGGQSRERGSL
KEISGAQLTAGPDRGAFGKHGYPLVVDEDIVNSTWGPGQDKKSFLEGGQLRVTLPGDSQS
QREGDCGRSLPRRSHLQGEDTESDLGFLERGQQGPGRVDSENGRWETAGGQSAGSSHPRD
RRLESRGEGQEHSEGHGSELDRYGQGQCHDPQLGAGAGQRVPWGSQFDAEGLQLKKEGTE
MWGDCLDVTEGRGNLRKERGTAAGSSNRARLWEARGGSGAGSPCVPEFPRGGAHSSKAGM
GPECWPGGDAGHGEAGVYWGAGGYPGQTSEGNDTQKSSLSGDRKLLGCTSPEAKAEGSFQ
SADGHGIVGRVYKPGPEGPEDLRSQKSGLQEIQGRNGQGSAGALGRTVEGSRSLQFPQSW
TVGQREAGKPGGAEYEDIGPQDDTWSNLREMGGHCGSGVLASGGREGSVGGSQVAALMMS
SQRVDARNHRLVTSPGLGVQGSGRTLGHMEGLRDPEAVGSEEEFWNGSGRSQGKGSRGGM
GLGGPEWAESRNEEGWENSEGMASRNGATCRDGSRMQEGTGSGPDIGCKAPCGAPAETES
GKWGTYSHDSGVPGGLWSGSKSQCSPAGKVSGREASLRNGSAGLHGMPSSEAQQRDVFQG
HGQTGHIGEHHCARGLGSSETVGSVGGHGRKDSGTAGKVGEGYTEAEPGHSGGLSSWGHT
GDYEDFRVLGAFREGDFGNGTGVPLSMGPRSLERGDKEGDGERISFLGARTSTVGTGNWD
KARHPGAPSPHEAGSEGHWAQVSGNALGCRDGSGIPEPWSAGDKTAYGEESKGLGPERTG
PDGEVAFRGSSSSLRGMGPASEASYKSGTWGPGAVGSGFKVDCRNDLGCSGSMGSESKAG
YKNKIESHGVRELGDLTGYKNDLGPSELISSRNEARGLEHSGDILSWNKAGLRDGLGETG
RMESKNGVGYRGSSVGPGEMGSERKMHLADGSGRLGGPGSLAAPKEHESVGLGSVYEGAA
EIGSKYNREKVRGMGFRDATGPEVGSGVAGMLDITGGIAHGDSAMGTEKLGTPDRPYILS
GGQGTKNSLGGCVSLGIPDALGAVGSVGKPGIREWKDDSGFQGSLRDRGTPSEEIRSVDQ
AGAIGTSRLLDSRGAVEDGSGSENDFDFNKSGLETTGRCRVADQQGVTPQGCGGSLLNGR
RKGTSSGSLSGVGQEVDRSSTPGRETKVMSGPGSGRATSHTRAADWEDGVQCSFGASSSL
PDTDAIFRETHAGQGAFKGRGCETGQGAAGECQGPRSLGSRGSEFVGGRAGFTGSSSVPG
RRDSTIYGDAVTSKPQEPQNELYSPLGRRDFKSVSGGIQEPGFQRGTGQGEGKESFQESG
SWEAELDEVQGSRASAKFENQGGKDPGWSGQKPGPCGSRHQVQSGTEVGSAKRATPQGAG
GLEPWAGSEDRGSLREPWSEDRRQGPHRHLGSRRDTQEGRSDVCGQAQDATQSPRSRYQP
GTGRSSSEARGSMDHFSQGLTDTEVQLGEAAIVSCTLASDLGPGTWFKDGVKLTAQDGVI
FEQDGLTHRLILTHVEGTQAGKYTFVAGCQHSEASLTVQDPPTIAPDVTETLREPLVFKA
GKPVTVKIPFQSRLPVQAAWRKDGNEVVGGDHKGIQLALADGYTWLCLPSVCRKDSGRYS
VTLRSEGGCVQAEFTLQVIDKPQPPQGPLEVQDCHRAGVCLRWLPPRDNGGQVIQHYVVE
RRQAGRSTWLKVGEPPSDSTSFTDTSVEQGKKYAFRVRAVTSVGAGDALESEEVLVAPEA
LPGPPSAPAILSASSQSITLTWGAPQGPGSNHILGYLIEKHKKGSNTWMAVNEQPVSERR
YTVVGLRQGCQYEFRVTAVTLSGPGDPGPPSDAVFARDPMRPPGPVRDLQVTDTSNTSIT
VSWMVPDARDADEAQGYIVELCGSDSHQWSPCHVGTVPGTTFTAKGLRPQEGYFVRVTAV
NDGGRSQATSLDTLVHAMPATVCPRFLMDSGTKDTLMVRVGDSIRVPLSFEAAPMPEVTW
LKDGLPLPKRSVTTVKAGLTQLLIPAASLSDCGRYTVMLRNLQGKEATHSFFINVAACPQ
APGSIYLQENVPGTVTVQWEPSPDEAQGIPLHYTVLMRSSSHRSWHEVADHVRTNRFTLL
GVLPGHEYHFRVLAKNELGVSKPSDTSQPWCIPRQRDRFTVKSPTYQDPDLSQKPRFLVG
LRAHLLPQGCECRMTCAVQGSPQPHVTWFKNDQSLDRNPAVYSTDLLGVCSLVIPSVSLK
DSGEYKAVAKNPLGQAVSTATLIVTEYDS
NT seq 8550 nt   +upstreamnt  +downstreamnt
atgaatgagatgcgaacacaagttagaattgagtttcatgctttggcaactcaaaggaag
ccttcagcatcacctcctaccattgaggaggacatgggccaaggttgtactctagaagct
ctggtcatccctagcagaagagctgagcaatcaactcagcacccagacagctcattcatg
gccacggtcagaggtgctaaatctgtagtagtcagtcaatggcagctgctacaggccgga
tccgcaggctctgccgccagaccagacggctccggctctgagtccctggcagccagcagc
agctggaaaccaagaaggaggctggaagctggtgggccatgcagatcatggctggtgttt
ctggtgtcacgggaaggatggagtgatagcaacccgggctatcgtaaacaattcatctgt
cgccctcaggagatcggtttccactcagaggagcacagagaagctgggactatggctgca
aagccccctaagaagtcctccatcccaggagtgagcatcaggcagctggtggacgagatc
ccagaaggctgcagcacaccagatttcaagcagaagcctgttaccttggctctaccagag
gggaaaaacgccatctttcgggcggtggtctgtggggaacccagacctgaagtgcactgg
cagagcagcaaaggagacctcagcaactccgccaagtaccagatatcctctgctcccggt
agagaggagcacgtgcttcagatcaacaagctgactggagaggattcggatctgtaccgc
tgcactgcactaaatgcctatggagaagccacatgctcagtgaggcttacggtcattgaa
gtgggttttcggaagaaccgaaaaaggcaaaaggaacctcaggaggacctcaggaaggag
ctgatggactttcggaagatgctgaaaaaacgggccccacccccaacccctgaaaaaaag
atggagtctgagcaggtgtggcagcttttggtgactgcagaccgtaaggactacgagaag
atctgtatgcagtatggtatcgtcgacttccggggcatgctgcgcaagttgcaggagatg
aaaaaggaacaggaggacagaatggcccagtatgtcagtgccattgccaacttgagacac
atcaaggtcaccaaggaaggggtcgctacgtttgacctggagctggatctcaagaacctc
gagagcaagatttacttgtacaaggatggtgagatgattccctacggtgttgataaccag
accaagcactgtctgagacggctggggaagcgctaccacttccagatccaggacctgcgg
cctgaggatgctggcctttaccaggtcatggtggaggatgctgtggtcttctctacagag
ctagaatccagaaccatcccccccagagtggtggtcccattggcagagacccgctgtgag
gaacggggtgatgcagtctttgaatgtaccctctccaatccctgtcccagtgcgacctgg
catttccagcaccgaccactgcggctcagtgacaaatatgaagtatttgtgtcccctgat
gggctaacccaccgactggttgtgaagggggccagtagctcagacatgggcctctactcg
ctgaacactgggctccatgcctccagtgcctggctggtggttgaaggtgggaaggataaa
ggccctcagaccacagatactgaccaccggctgcagactccagaagctctggcctccgaa
gcagaagacgctggaggcatcagcatcaagggagggcaatccagagagcggggttccctc
aaagagattagtggggcacagctcacagcaggcccagacaggggtgcctttggcaaacat
ggctatcccttggtggtggatgaagacatagttaattctacttggggacctgggcaggac
aaaaagagctttctggaaggaggacaactcagggtcactcttccaggggatagtcagtcc
caaagagagggagactgtggtagaagcctccccagaaggtctcatctccagggagaggat
acagaatcagatttgggcttcctggagagaggacaacaagggcctggtagagttgacagt
gagaatggcagatgggagacagcaggaggccagagtgctggctccagccatcctcgggac
agaaggcttgagagcagaggagaaggacaggaacacagtgagggccatggcagtgaactg
gacagatatggccagggacaatgccatgatcctcagctgggagcaggggcagggcagagg
gtgccgtggggatcccagtttgatgctgaggggcttcagctgaaaaaggaggggacagaa
atgtggggcgattgtctggatgtgacggaaggtaggggtaacctgagaaaggagagggga
acagcagcagggtcaagtaacagagcccgcctctgggaagctcgaggaggcagtggggcc
ggaagtccttgcgtccctgagtttcctagaggaggagctcacagctccaaggcaggcatg
ggccctgagtgctggccaggtggagatgctggccatggagaagctggggtatactggggg
gcagggggatatccaggacagacatctgagggcaatgacacccagaaatcatcactatct
ggagacaggaaacttctggggtgcacgagtcctgaggccaaagctgagggctctttccag
agcgcagatggtcatgggattgtggggagggtctacaaacctggccctgaaggcccagaa
gatcttaggagtcagaaaagtggcctacaagagattcagggaaggaatggtcaaggctca
gctggagccttgggcaggacggtggaaggttccagaagcctccaatttcctcagagctgg
acagtgggacagagggaagcagggaagccaggtggagcagagtatgaagacataggtcct
caggatgacacgtggtccaatctcagagagatgggaggccactgtgggtctggagtgctg
gcgtctggtgggagggaagggagcgtgggcggttcccaagtagctgccctgatgatgtct
agtcagagggtagatgccagaaaccacaggctagttacatccccaggcctgggtgtccag
ggttctggcagaacactgggacacatggaaggattaagagacccagaggcagtgggatcc
gaagaagagttctggaatgggtcaggaaggtcccaaggaaaagggtccagaggtgggatg
ggcttaggaggtccagagtgggcagagtctaggaatgaggagggatgggagaattctgaa
gggatggcttctaggaatggagccacttgtcgtgatggatccaggatgcaggaaggaaca
ggatctggccctgatattggttgcaaggccccctgtggggcacctgcggagacagagtct
gggaagtggggtacttacagtcatgactcaggggtgcctgggggattgtggtctggaagc
aaaagtcagtgtagtcctgcaggaaaggtatctggaagagaggccagcctcagaaatggc
tcagctggccttcatggaatgccttctagtgaagctcagcagagggatgtatttcaaggc
cacggtcagacaggccacattggagagcaccactgtgcccgtggcttagggagttctgag
acagtgggatctgtgggtggacatggtaggaaagactctggaacagcgggcaaggttgga
gagggatacacagaagcagaaccagggcactctggagggttgagttcttggggtcacact
ggagattatgaggacttccgagtcctgggggcctttagggaaggagactttggcaatggc
actggggttccattatccatgggaccaaggtctctggagagaggggacaaggaaggagat
ggagaaaggatcagttttcttggtgccaggacctctacagttggaactgggaattgggac
aaagccaggcaccctggggcaccatctcctcatgaggccggttcagagggccactgggct
caagtgtctggcaatgcattaggttgtagagatgggtctggaattccagagccttggagt
gctggcgacaaaacagcttatggagaagaatcaaagggtcttgggcctgaaagaacagga
ccagatggtgaggtggcatttagaggtagctcttcgagcctcagaggaatgggaccagca
agtgaggcaagttataaaagtggaacttggggccctggggctgtgggttcagggtttaag
gtagattgtaggaatgatcttgggtgttctggaagtatggggtcagagagtaaagcaggt
tataagaacaaaattgagagtcatggggtcagggagttaggggacctgacaggctataaa
aatgatttaggaccttctgaacttatttcatcaaggaatgaggcacgtggtttagaacat
tctggagacattttgtcatggaataaggcaggtttaagggatggcttgggagaaacagga
agaatggagtccaagaatggggttggttataggggaagctcagtgggtcctggggaaatg
gggtcagagaggaaaatgcaccttgcagatggttcagggaggctaggaggaccagggtca
ctggctgcgcccaaagaacatgaatctgtgggtcttgggtcagtttatgagggagcagca
gagattggctccaaatataatagggagaaagtcagaggaatggggtttagagatgcaaca
gggcctgaggtgggctctggggtagctggaatgctggatattacaggtggcatagcacac
ggggacagtgctatgggcacagagaagctggggacaccagataggccttatatcttgtca
ggtgggcagggtaccaagaacagtcttgggggctgtgtgtccttgggaatccctgacgcc
ttgggggctgttggctctgtggggaaaccaggtatcagagaatggaaagatgattctggg
ttccaagggtctctcagggacagagggactccgagtgaggagatcagatctgtagaccaa
gcaggagctatagggacatctcggcttcttgatagtaggggggcagtggaggatgggagt
gggtcagaaaatgactttgactttaataaatcaggcttggagacaacaggaagatgtaga
gttgctgaccagcagggagtgacaccacagggatgtggaggctcattgctcaatggcagg
aggaagggaacaagttctggaagcttgtcaggggtagggcaggaggtagacagaagttct
acacctgggagggagaccaaggtaatgtcaggacctggcagtgggcgagccacaagccac
actcgggctgcagactgggaagacggggttcaatgcagcttcggggcttctagctcactg
cctgatactgatgccattttcagagaaacccatgcgggacaaggagccttcaagggcagg
ggctgtgaaaccggccaaggggctgctggagagtgtcaaggaccacgctccttggggagc
agaggctcagagtttgtagggggcagggctggatttacagggagctcaagtgttccaggc
agaagggattccactatctacggagatgctgtcacatcaaagccacaggaaccccagaat
gaattatatagtcctttaggcagaagggacttcaaaagtgtatcgggaggaatccaggag
ccaggttttcaacgaggaacaggacagggagaaggaaaagaatccttccaggagtcaggg
tcctgggaggctgagcttgacgaggtccaaggatccagggcctcagcaaagtttgaaaac
cagggagggaaagaccctggctggtcaggccagaagcctggtccctgtggaagcaggcat
caggtgcagtctgggactgaagttggatcagcaaagagagcaaccccacagggggccgga
gggctggagccttgggctggcagtgaggatagagggtctctgagagaaccttggagtgaa
gacaggaggcaaggcccccacaggcaccttggcagcaggagagatacccaagagggcagg
tcagatgtctgtggccaggcacaagatgctacccagagccccagatccagataccagcct
ggcactggccgctcttcttcagaggcccgaggctccatggaccacttctctcagggtctg
actgatacagaggtgcaactgggggaagccgccatagtctcctgtactcttgccagtgac
ctgggacctggcacgtggttcaaggatggagtcaagctcactgcccaagatggagtcatc
tttgagcaagatgggctcacgcacagactgattctcacccacgtggaggggacccaggct
gggaaatacacttttgtagccggctgccagcacagcgaggccagcctgaccgtgcaggat
ccccccaccattgctccagatgtgacagagacactgagagagccactggtgttcaaggct
gggaagccagtcaccgtgaaaatccctttccagagccgcctccctgttcaggctgcctgg
aggaaagatgggaacgaggtggtgggcggcgaccacaagggcatccaactggctctggca
gatggctacacatggctgtgcctccccagcgtgtgcaggaaggacagtggccggtacagc
gtgacgctgaggagcgagggaggctgtgtgcaggctgagttcaccctgcaagttatagac
aagcctcagcccccacaaggacccctggaggttcaggattgccacagagcaggtgtctgc
ctccgctggctacccccgagggacaacgggggccaggtcatacaacactatgtggtggag
aggcgacaggctggaaggagcacttggttgaaggtgggcgagcccccatcagacagtacc
agcttcaccgacaccagcgtggagcagggaaagaaatatgccttccgtgtgcgggctgtg
acctcagtgggagccggagatgccctggagtcagaggaggtgttggtggctcctgaggct
ctcccggggcccccttctgccccagccatcctgtcagcctccagtcagagcatcactctc
acatggggggcaccacagggccctggcagtaaccacatcctgggctacctgatcgagaag
cacaagaaggggagcaacacctggatggctgtgaatgagcagcccgtgtctgaaagaagg
tacactgtggtgggtctgcgacagggctgccagtatgagttccgggtcacggccgtgact
ctgtcgggccctggagatcctgggcctccatcggatgctgtctttgctagagaccctatg
agacccccagggcctgtgcgggatctacaggttacagacacatcaaacactagcatcacc
gtgagctggatggtgccggatgcccgggatgctgatgaagcccagggatatattgtggag
ttgtgtggttcagacagccatcaatggagcccatgtcacgtgggaactgtgccgggcacc
accttcacagccaaggggcttcggccgcaagaaggctactttgtgcgggtgacagcagtt
aatgatgggggccggagccaggccacttccctggacacattggttcatgccatgccggcc
actgtctgtcccaggttcctcatggactccggcacaaaggataccctgatggtcagggtt
ggggacagtattcgcgttcctctctcctttgaagctgcccccatgcctgaggtgacctgg
ctgaaggacggcttgcccttgcccaaaagaagtgtgaccactgtgaaggctggcctcacg
cagcttctgatccctgcagctagcctctcggactgtggccgatacaccgtgatgctgagg
aacctacaggggaaggaagctacccacagcttcttcatcaatgtagcagcatgcccacag
gcaccaggttctatctacctacaggagaatgtgcctgggacagtgacggtccagtgggaa
ccctctccggatgaggctcagggcatccccttgcattacacagtgctgatgcggtcctca
tctcaccgatcctggcacgaggtggccgaccatgtccgtaccaaccgctttaccctccta
ggggtcctccctggccatgagtaccactttcgggtgctggccaagaatgagctgggggtc
agcaaaccttcagacaccagccaaccctggtgtatccccaggcagagagacaggttcaca
gtgaagtctccgacataccaggatcctgacctgagccagaagccccgcttcctggtgggt
ctgcgggctcaccttctgccccagggctgtgagtgccgcatgacgtgtgccgtgcagggc
tcaccccagcctcatgtcacctggttcaagaatgaccaaagcttggacagaaaccctgcg
gtgtacagtactgacttgctgggtgtgtgctccctcgtcatccccagcgtgtcccttaag
gacagtggtgaatacaaggctgtggccaagaacccactgggacaagctgtcagcacagcc
accctcattgtcacagaatacgactcctag

DBGET integrated database retrieval system