KEGG   Mus musculus (mouse): 226539
Entry
226539            CDS       T01002                                 

Gene name
Dars2, 5830468K18Rik, aspRS
Definition
(RefSeq) aspartyl-tRNA synthetase 2 (mitochondrial)
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    226539 (Dars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    226539 (Dars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    226539 (Dars2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    226539 (Dars2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     226539 (Dars2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   226539 (Dars2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    226539 (Dars2)
 Prokaryotic type
   Other AARSs
    226539 (Dars2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    226539 (Dars2)
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Other DBs
NCBI-GeneID: 226539
NCBI-ProteinID: NP_766232
MGI: 2442510
Ensembl: ENSMUSG00000026709
Vega: OTTMUSG00000031015
UniProt: Q8BIP0
Position
1; 1 H2.1
AA seq 653 aa
MYLGFWLSRLCRGLSRPIGKTMRPIWGSLSRNLALSSQRIPEFSSFVARTNTCGELRSSH
LGQEVTLCGWIQYRRQNTFLVLRDCHGLVQILIPQDESAASVRRILCEAPVESVVRVSGT
VISRPPGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKDFVKKTEALRLQYRYLDLRSF
QMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQ
SPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVEQTGIQRLVEGLL
QYSWPGDKDPLVTPFPSMTFAEALATYGTDKPDTRFGMKIVDVSDVFRNTELRFLQDALA
KPQGTVKAICVHDGAKYLRKEDIEFIRKFAVHHFSQEVLPIFLNAKKNWSSPFAKFIMEE
ERLELARSMEIQEEDIVLLTAGEHEKACSLLGKLRLECADLLEMRGAVLRDPAVFSFLWV
VDFPLFLAKEESPTELESAHHPFTAPNSSDIHLLYTEPEKVRGQHYDLVLNGNEIGGGSV
RIHDAQLQRYILETLLKEDVKLLSHLLQALDYGAPPHGGIALGLDRLVCLVTGAPSIRDV
IAFPKSYRGQDLMSNAPDSVSPEELKPYHIHVLWPADSEEESASATPSKHLSS
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgtatcttggtttttggttaagtcgtctatgcaggggtttatccagacccatcgggaag
accatgcggccaatctggggttctctttccagaaatctggcgttgagttcacaaagaatt
ccagaattcagtagctttgttgctcggaccaacacatgtggagagttgcgttcgtcccac
ttaggccaagaagtcactctgtgtggatggattcagtaccgcaggcagaacaccttctta
gtcctaagagattgccacggccttgttcagattctcattccccaggatgagtcagccgca
tctgtgaggaggattttgtgtgaagcccctgtggagtctgtggtgagagtatctgggaca
gtaatctcccgtcctccaggacaagagaatccgaaaatgccgacgggtgagattgaaatc
aaagttaaaacagctgagctcctgaatgcctgcaaaaagctgccctttgagattaaagac
tttgtgaagaaaacagaggcgctccgtttgcagtatcgctacttagatctgcgcagcttc
cagatgcagtacaacttgcggctgaggtcgcagatggtcatgaaaatgcgggaatatctc
tgtaatctgcacgggtttgtggatatagaaaccccaaccttgtttaagaggacccctgga
ggtgccaaggagtttttagtaccatccagggaacctggaaagttttattccctccctcaa
agtcctcagcaatttaagcagcttctgatggttggaggtttagacaggtattttcaggtc
gctcggtgttaccgagatgaaggctcaagaccggatagacagccagagttcactcagatt
gacatagagatgtcctttgtagagcagactggcattcagcgtttagttgagggtttgctg
cagtattcctggcctggtgataaagaccctctagtgactcctttcccttccatgactttt
gctgaggcactggccacctatggaactgataagccagatactcgctttgggatgaagatt
gtggatgtcagtgatgtgttcagaaacacagagctcagattccttcaggatgcactggct
aagccccaaggaactgtcaaagcaatatgtgttcatgacggagcgaaatacttaaggaag
gaagacattgagttcattaggaagtttgcagttcaccatttcagtcaggaagtcctacct
atattcctgaatgccaagaagaactggagttcgccatttgctaagttcataatggaggag
gaaagactggaattagccagatcgatggagatacaagaagaagacatagtgttactgact
gctggggaacatgagaaagcatgctctctgttgggaaagttacggctagagtgtgcagac
cttttggagatgagaggagcggtgctccgagacccagcagtgttctcttttctttgggtg
gttgactttccactcttccttgccaaggaagagagtcccacagagctggagtcagcccat
cacccatttactgctcctaactccagtgacattcacctcctctatactgagccggaaaag
gttcgtggccaacactatgacttggttttaaacggcaatgagataggaggtggttctgtc
cgaatccatgatgcacagctacagaggtacatcctggaaacactgctaaaggaagatgtg
aaattgctttcccatctgcttcaggctttagactatggggcacccccacacggaggaatt
gccttagggttagacagactggtatgtcttgtcacgggagcacccagcatcagagatgtc
atagccttccctaaatcctaccgaggacaggaccttatgagcaatgctccagactccgtg
tctccagaagagctgaagccttaccatatccacgtcttgtggccagcagactcagaagag
gagagtgcatccgccacaccttccaaacacttgagctcttaa

DBGET integrated database retrieval system