KEGG   Mus musculus (house mouse): 226541
Entry
226541            CDS       T01002                                 
Symbol
Klhl20, AI504637, D930050H05Rik, Kleip, mKIAA4210
Name
(RefSeq) kelch-like 20
  KO
K10457  kelch-like protein 20
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    226541 (Klhl20)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     226541 (Klhl20)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_4 BTB Kelch_3 Kelch_2
Other DBs
NCBI-GeneID: 226541
NCBI-ProteinID: NP_001034571
MGI: 2444855
Ensembl: ENSMUSG00000026705
UniProt: Q8VCK5
Position
1:complement(160915945..160959078)
AA seq 604 aa
MRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINLLRKHR
ELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDF
AYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCREL
LRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQE
RRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQG
PRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDD
LLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVS
CLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQEN
RWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRS
GVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIKMTHCE
SHIW
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgcgcaggtgtaccaacattcgaccaggagagactggaatggatgtaacaagccgctgc
acccttggagaccccaacaagctgccagaaggggttccccaacctgctcgcatgccctat
atttcagacaagcaccctcggcaaaccttggaagtgatcaaccttctgagaaagcaccgg
gagctatgtgatgtggtgctagttgtgggcgctaagaagatatatgcccaccgcgtcatc
ctgtcagcctgcagcccctacttccgagcaatgtttacaggggagctggcagaaagccgg
cagacagaagtagtgatccgagacatagatgagagggccatggagctcctgattgacttt
gcatatacctcccagatcactgtggaagagggcaatgttcagactctcttgcctgctgct
tgcctcctccagctggcagaaatacaggaagcctgctgtgaattcttaaagagacaatta
gatccttctaattgtctgggcattcgggcttttgctgacacacattcttgccgtgagttg
ctaaggattgcagacaagttcacccaacataactttcaagaggtaatggagagtgaagaa
ttcatgttacttccggccaaccaactcattgacataatatctagtgatgagctcaatgtt
cggagtgaagaacaagtgttcaatgcagtgatggcctgggtcaaatacagtattcaggaa
agacggcctcagttaccccaggtgctgcaacatgttcgcctgcctttgcttagtcccaag
ttcctggtgggcaccgtaggctctgaccccctcattaaaagtgatgaagaatgcagagac
ttggtagatgaggctaaaaactacctcctgttgcctcaagaacgaccactaatgcaaggg
ccaaggacaagaccacggaaacctatccgatgcggagaagtactctttgcagttggtggt
tggtgcagtggagatgccatttccagtgttgaacgctatgacccccagaccaatgagtgg
cgaatggtagcttcaatgagcaaaaggcgatgtggagtcggggtcagtgttcttgatgac
ctgttatatgcagtaggcggccatgatggatcctcatatctcaatagtgttgaaagatat
gaccccaaaactaaccaatggagcagcgatgtggcccctacaagcacctgcaggacaagc
gttggtgtggcagtccttggaggttttctctatgctgtgggtggacaggatggtgtctct
tgcctcaatatagttgagaggtatgatccaaaggagaacaagtggacccgggtggcttca
atgagcactagaaggctaggggtggctgtcgccgtgttgggagggttcttatacgctgtt
ggtggctcagatggaacatctccacttaacacagtggagcgctacaatcctcaggaaaac
agatggcacaccatagcgcctatggggacccgaagaaaacacctaggctgtgcggtgtac
caggacatgatctatgcagtgggagggagagacgacactacagagcttagcagtgctgag
agatacaaccccagaactaaccagtggtctcccgtggtggccatgacatcccgcaggagt
ggagtcggcctggccgtggtcaatggacagcttatggcagtggggggctttgatggcaca
acatacttgaagaccattgaagtttttgacccagatgccaatacgtggaggttatacgga
gggatgaattaccgtcggctaggaggtggtgtaggagttattaaaatgacacattgtgaa
tcccatatatggtga

DBGET integrated database retrieval system