KEGG   Mus musculus (mouse): 22658Help
Entry
22658             CDS       T01002                                 

Gene name
Pcgf2, Mel18, Rnf110, Zfp144, mel-18
Definition
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22658 (Pcgf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22658 (Pcgf2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     22658 (Pcgf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 Rad60-SLD zf-Nse zf-ANAPC11 zf-RING_10 FAP
Motif
Other DBs
NCBI-GeneID: 22658
NCBI-ProteinID: NP_001156779
MGI: 99161
Ensembl: ENSMUSG00000018537
Vega: OTTMUSG00000002751
UniProt: P23798
Position
11 D; 11 61.06 cM
AA seq 342 aa AA seqDB search
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggaccacacggattaaaatcacggagctgaaccctcacctcatgtgtgccctc
tgtgggggctattttattgatgccaccaccattgtggaatgcttacattccttctgcaaa
acctgcatcgtacgctacttggagaccaacaaatactgccccatgtgtgacgtccaggtc
cataaaactcgaccactgctgagcatcagatcagacaaaaccctccaggacattgtctac
aagttggtgcctgggctttttaaagatgaaatgaaacggcgacgggacttctatgcagca
taccccctgacagaggtccccaacggctccaacgaggaccgaggcgaggtcctggaacag
gagaagggggctctgggtgacgacgagattgtcagtctttccattgagttctacgaaggc
gtcagggaccgagaggagaagaagaacctcacggagaatggagatggggacaaggagaag
acaggagtgcgattcctgcggtgcccagcagccatgaccgtcatgcacctggcaaagttc
ctccgcaacaaaatggatgtgcccagcaagtacaaggtggagatcctctatgaagatgag
cccctgaaggaatactacaccttaatggacattgcgtacatctacccctggcgaaggaat
gggcctctccccctcaagtaccgtgtccagccagcctgcaagcggctcaccctgcccacg
gtgccaaccccctcagaaggcaccaacaccagcggggcatcagagtgtgagtcagtcagc
gacaaggctcccagccctgccacccttccggccacctcctcctccttgcccagccctgcg
accccatcccatggctctcccagctcccacggccccccagctacccatcctacttccccc
actccaccttcaactgccgctgggaccaccacagctaccaatgggggcacttcgaactgc
ctgcaaacgccatcctccaccagcagggggcgcaagatgactgttaatggcgctccttgc
cccccttga

DBGET integrated database retrieval system