KEGG   Mus musculus (mouse): 226610
Entry
226610            CDS       T01002                                 

Gene name
Fam78b, C030014K22Rik, C030020L09Rik
Definition
(RefSeq) family with sequence similarity 78, member B
Organism
mmu  Mus musculus (mouse)
SSDB
Other DBs
NCBI-GeneID: 226610
NCBI-ProteinID: NP_001153733
MGI: 2443050
Ensembl: ENSMUSG00000060568
Vega: OTTMUSG00000033956
UniProt: Q8BQN5
Position
1; 1 H2.3
AA seq 261 aa
MGCIQSITCKARIRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASARVVMPPI
PRHETWVVGWIQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTE
TVTLVGPTNKISRFSVSMNDNFYPSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTT
KEKIILQTIKWRMRVDIEVDPLQLLGQRARLVGRTQQEQPRILSRMEPIPPNALVKPNAN
DAQVLMWRPKRGPPLVVIPPK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggctgtatccaaagcatcacctgcaaggcgcggatccggcgcgagaacatcgtggtg
tacgatgtgtgcgccaccatcgaccagtgccccacgcgcatcgaggagacctcgcccatc
gtcctgcgctacaagaccccttacttcaaagcctcggcccgtgtggtcatgccccccatc
ccccgccacgagacctgggtggtgggctggatccaggcatgcaaccagatggagttcttc
aacacctacagcgacctgggcatgtcaagctgggaactgcctgacttgagggaagggaga
gtaaaagccatcagtgactcagacggggtgagctacccatggtacgggaacacgacagag
actgtgaccctggttggccccaccaacaagatctccaggttctccgtcagcatgaatgat
aacttctaccccagcgtgacatgggcagtgccagtgagtgacagcaatgtgccactgctc
acaaggatcaagagggaccaaagttttaccacatggctggtggccatgaacaccaccacc
aaggaaaagatcatactgcagaccatcaaatggaggatgagagtggacattgaagtggac
cctcttcagctgttggggcagcgggcccggctagtgggcaggactcagcaggagcagccc
cggatcctgagccggatggagcccatcccccctaacgcactagtgaagcccaatgccaac
gatgcccaggtcctcatgtggaggcccaagcggggaccacctctggttgtgatacctcct
aagtaa

DBGET integrated database retrieval system