KEGG   Mus musculus (mouse): 226641
Entry
226641            CDS       T01002                                 

Gene name
Atf6, 9130025P16Rik, 9630036G24, AA789574, Atf6alpha, ESTM49
Definition
(RefSeq) activating transcription factor 6
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    226641 (Atf6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    226641 (Atf6)
   05012 Parkinson disease
    226641 (Atf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    226641 (Atf6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    226641 (Atf6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf AIRC Docking UPF0242
Other DBs
NCBI-GeneID: 226641
NCBI-ProteinID: NP_001074773
MGI: 1926157
Ensembl: ENSMUSG00000026663
Vega: OTTMUSG00000043564
UniProt: F6VAN0
Position
1 H3; 1 76.96 cM
AA seq 656 aa
MESPFSPVLPHGPDEDWESTLFAELGYFTDTDDVHFDAAHEAYENNFDHLNFDLDLMPWE
SDLWSPGSHFCSDMKAEPQPLSPASSSCSISSPRSTDSCSSTQHVPEELDLLSSSQSPLS
LYGDSCNSPSSVEPLKEEKPVTGPGNKTEHGLTPKKKIQMSSKPSVQPKPLLLPAAPKTQ
TNASVPAKAIIIQTLPALMPLAKQQSIISIQPAPTKGQTVLLSQPTVVQLQSPAVLSSAQ
PVLAVTGGAAQLPNHVVNVLPAPVVSSPVNGKLSVTKPVLQSATRSMGSDIAVLRRQQRM
IKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGSLKRQLDEVVSENQRLKVPS
PKRRAVCVMIVLAFIMLNYGPMSMLEQESRRVKPSVSPANQRRHLLEFSAKEVKDTSDGD
NQKDSYSYDHSVSNDKALMVLSEEPLLYMPPPPCQPLINTTESLRLNHELRGWVHRHEVE
RTKSRRMTNSQQKARILQGALEQGSNSQLMAVQYTETTSISRNSGSELQVYYASPGSYQG
FFDAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININDNVINGQDYEVMM
QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVSTIPESLQ
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggagtcgccttttagtccggttcttcctcatggaccagatgaagactgggagtcgacg
ttgtttgctgaacttggctatttcacagacactgatgatgtgcactttgatgcagcacat
gaggcttatgaaaataattttgatcatcttaattttgatttggatttgatgccttgggag
tcagacctatggagccccggcagccacttctgctcagacatgaaggcagagccccagcct
ctttctccggcttcctccagttgctccatctcctctcctcggtccacagactcgtgttct
tcaactcagcacgttcctgaggagttggatttgttgtctagttctcagtcccccctttcc
ttatatggcgacagctgtaatagcccctcctctgtagagccactgaaggaagagaagcct
gtcactggtcctggaaacaaaacagaacatggactgactccaaagaaaaaaattcagatg
agttcaaaaccttcagttcagcccaagcctttattacttccagcagcgcccaagactcaa
accaatgccagtgtcccagcaaaagccatcatcattcagacactaccagcccttatgcca
ctggcaaagcagcagtcgattatcagcatacagcctgcgcccaccaaaggccagactgtt
ttgctctctcagccgactgtggttcaacttcagagccctgcggttctgtcgtctgctcag
ccggttcttgcagtcactgggggagccgcacagctacctaaccatgtggtgaatgtgctg
ccagcccctgtggtgagcagcccggtgaatggaaaactttccgtgactaaacctgttcta
caaagtgccaccagaagtatgggttcggatatcgctgtgctgaggagacagcagcggatg
ataaagaaccgagagtctgcttgtcagtcgcgcaagaagaagaaagagtatatgctagga
ctggaggccaggctcaaggctgccctctcagagaatgagcagctgaagaaggagaatggc
tccctgaagcgacagctggacgaggtggtgtcagagaaccagaggctcaaagtcccaagt
ccaaagcgaagagctgtctgtgtgatgatagtattagcatttataatgctgaactatggg
cccatgagcatgctggagcaagaatcccgaagagtgaaacctagtgtgagccctgccaat
cagaggaggcatctcttggaattttcagcaaaagaagttaaagacacatcagatggtgac
aaccagaaagacagttacagctatgatcactctgtgtccaatgacaaagctttaatggtg
ctaagtgaagagccattgctttatatgcctccacctccatgtcaacccctgattaacaca
acagagtctctcaggttgaaccatgaacttcgaggctgggttcatagacatgaagtggaa
aggaccaaatctagaagaatgacaaatagccaacagaaagcccgcattctccagggtgct
ctggaacagggctctaattctcagctgatggctgtccagtacacagaaaccactagcatc
agtaggaattctgggagtgagctgcaagtgtattacgcctcccctggaagttaccaaggc
ttctttgacgccatccgcaggaggggagatacgttttacgttgtctcatttcgaagggat
catctgctattaccagctaccacccacaacaagaccacaagaccaaaaatgtcaattgta
ttaccagcaataaacataaatgataatgtgatcaatgggcaggactatgaagtaatgatg
cagattgactgtcaggtgatggacaccaggatcctccacatcaaaagctcctcggttccc
ccttatctccgggatcatcagcggaaccaaaccagcaccttctttggttcccctccaaca
accacagagacgacccatgtggtcagcaccatccctgagtcgttgcagtag

DBGET integrated database retrieval system