KEGG   Mus musculus (mouse): 226747Help
Entry
226747            CDS       T01002                                 

Gene name
Ahctf1, 6230412P20Rik, AV011447, Elys
Definition
(RefSeq) AT hook containing transcription factor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ELYS-bb ELYS
Motif
Other DBs
NCBI-GeneID: 226747
NCBI-ProteinID: NP_080651
MGI: 1915033
Ensembl: ENSMUSG00000026491
Vega: OTTMUSG00000033771
UniProt: Q8CJF7
Structure
PDB: 

Position
1 H4; 1 83.62 cM
AA seq 2243 aa AA seqDB search
MQDLTAQVTSDLLHFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSL
TGERLSAYRFSGVNEQPPVVLAVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCSQN
EVEASDLEVITGIPAEVPHIRERVMREGRHLCFQLVSPLGVAISTLSYINRTNQLAVGFS
DGYLALWNMKSMKREYYTQLEGGRVPVHAVAFQEPENDPRNCCYLWAVQSTQDSEGDVLS
LHLLQLAFGDRKCLASGQILYEGLEYCEERYTLDLAGGTFPLRGQTSNTKLLGCQSIERF
PSHGDREESMREALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINRWYHAQMPDSLRSGE
SLHNCSYFALWSLDSVVSRTSPHHILDILVHERSLNRGVPPSYPPPEQFFNPSTFNFDAT
CLLDSGVIHVTCAGFQKETLTFLKKSGPTLNEVIPDSYNRCLVAGLLSPRLIDIQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRTWIIEEQPNSAANLRFVLEWTWNKVVLTKEEFDR
LCVPLFDGSCRFIDPQTIQSIQQCHLLLSNLSTVLSCFAMEAQGITERGLVDLSNKHMVT
QLLCQYAHMVLWFCHSGLLPEGLDDALQLSRLRYNYPVIQNYYTSRRQKSERSPRGKWNH
DCLMIDGLVSQLGDEVEKLWKRDEGGTGRYPPASIHALLDIYLLDNITEASKHAITIYLL
LDIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPAS
WQHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSNEVILHLTVLLFNRCMVEAWNLLRQNS
NRVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVKFLQSSTSVENHEFLLVHHLQ
RANYISALKLNQILKNNLMSDRDPRLRERSVTRNSILDQYGKILPRVQRKLAVERAKPYH
LSTSSVFHEVSRPKPLSAFPKKAITGTVLTRSTFISNVLSKIGEVWASHEPRNGVSLFNS
PKTEQPSPVVHSFPHPELPEAFVGTPISNTSQRISRLLDLVVHPVPQPSQCLEFIQQSPT
RSPLCLLSSSLPLSSQFKRPHQNTSRPSELLLLETPLIVKKAKSLALSATSSGFAEFTPP
SILRSGFRTTPLASPSLSPGRSLTPPFRVKETRISFMEEGMNTHWTDRATDDRNTKAFVS
TSFHKCGLPAETEWMKTSDKNTYFPLDVPAKGPQKVVAESLATHSGRLEKLDVSKEDSTA
STRSDQTSLEYHDAPSPEDLEGAVFVSPKPASSSTELTTNSTLQTERDNDKDAFKSEGAP
SPVKKQIGTGDAAVEAFSELSRLDPVERAEASFAVSSVCEGETSTSNSKTSVLDGIVPIE
SRTSILTADHKESVANTVADVESSGSTSSKCPVTSERSLGQKLTLNLKEDEIEAHVPKEN
VGLPEESPRISAAPSDTHEIHLIGCENLEVQNSEEEAKNLSFDELYPLGAEKLEYNLSTI
EQQFCDLPDDKDSAECDAAEVDGELFVAQSNFTLILEGEEGEAEASDSAAPNMLPKATKE
KPVCHREPHNQERVTDLPSAVTADQESHKVETLPYVPEPVKVAIAENLLDVIKDTRSKEA
TPVAAGEAGDEDGAVIVSKAAHSSRLTNSTPKTVKEPHAETVNTSQNDDMVSSRTLTRRQ
HALSLNVTSEQEPSAVATPKKRTRKIKETPESSERTCSDLKVAPENQLTAQSPPAPRRGK
KKDVSQGTLPSSGAVEPEPEPQGTPGRLRLRTQPPEPAAEETPSRTKVRLSSVRKGTPRR
LKKSVENGQSTEILDDLKGSEAASHDGTVTELRNANLEDTQNMEYKQDEHSDQQLPLKRK
RVREREVSVSSVTEEPKLDSSQLPLQTGLDVPATPRKRGRPRKVVPLEADGGTTGKEQTS
PQKKDVPVVRRSTRNTPARNVSTLEKSVLVPNKEAALVVTSKRRPTKKSAEESSKDPSAA
VSDLAGGAAHTESADRRDGLLAAAALTPSAQGTRTRSRRTMLLTDISEPKTEPLFPPPSV
KVPKKKSKAENMEAAAQLKELVSDLSSQFVVSPPALRTRQKSISNTSKLLGELESDPKPL
EIIEQKPKRSRTVKTRASRNTGKGSSWSPPPVEIKLVSPLASPVDEIKTGKPRKTAEIAG
KTLGRGRKKPSSFPKQILRRKML
NT seq 6732 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacttgacagctcaagtgactagtgatctcctgcatttcccagaagtgactatt
gaagctcttggagaagatgagataacattagagtccgtgcttcgtggaaagtttgctgca
gggaaaaatggactagcatgcttagcttgtggtccacaacttgaagttgtaaactcccta
acaggagagcggttatctgcatatagattcagtggagtaaatgaacagcctcctgtagtc
cttgcagtgaaagaattctcttggcataagaggactggattgttaataggattggaagaa
gcagatgggagtgttctttgtctttatgaccttggtatatcaagagtggtcaaagcagtt
gttcttcctggaagggtaacagctatcgagcctataattaaccatggaggagccagtgcg
agtacccagcatttacatccaagtctccggtggctttttggcgtggccgctgtggtgact
gatgttggacagatccttcttattgacctgtgtttggatgacttgtcctgcagtcagaat
gaagttgaggcatcagaccttgaagttatcactggtatcccagctgaagtaccacacatc
agagagagagtgatgagagaggggcgccacctgtgcttccagttagtaagcccattggga
gtagccatttctactctgagttacatcaacaggacaaatcagcttgctgtgggtttttct
gatggctacttagcactttggaacatgaaaagcatgaaaagagaatactatacacagttg
gaaggtggaagggttcctgtccatgcagttgcctttcaagagcctgagaatgatcctcgt
aactgctgttatttatgggctgttcagtccacacaagatagtgaaggggatgttttgagt
ttgcatctgcttcagctggcttttggtgatagaaaatgtttggcatcagggcaaatttta
tatgagggattagaatactgcgaagaaagatatacactggatctagcaggtggcacgttc
cccttaaggggacaaactagtaataccaaattgttgggatgccagagtatagagagattt
ccatctcatggagacagagaagaaagtatgagagaagctctgtctcccgataccagcgtt
tctgtctttacctggcaagtgaatatatatggacagggaaagccttctgtgtatttaggg
ctatttgacataaatcgttggtatcatgcacaaatgcccgattctttaagatcaggagaa
tctctgcataattgctcttattttgcgttgtggtcattggattcggttgtaagtaggact
tctccacatcacatcttggacatactagtacatgagaggagtttaaaccgaggggttcct
ccttcctacccacctccagagcaattttttaacccaagtacttttaattttgatgccact
tgtttgttagactctggagttatccatgtaacttgtgctggatttcagaaggagactttg
acatttttaaagaaatcaggaccaactcttaatgaagtcattcctgatagttataatcga
tgtcttgttgctggtctcctctcaccaagacttattgatattcagccttccagtttaagt
caagaagaacaattagaagctatattgtcagcagcaattcagacaagttccttgggactt
ttgactggttacatcagaacgtggataatagaagaacaaccaaattctgctgctaatcta
cgatttgttcttgagtggacatggaataaagtggttctcacaaaagaagagtttgatagg
ctttgtgtgccgctgtttgacggttcgtgtcgttttattgacccacagactattcagtct
atccagcagtgccatttactgcttagcaaccttagtacagtcttaagctgttttgcaatg
gaggcccagggtatcactgagagaggactggtggacttgagcaacaagcacatggtcacc
cagcttctctgtcagtacgcacacatggttctgtggttctgccactcggggcttctgccc
gaaggcttagatgatgctctgcagctgtcaagactacgctacaactaccctgtaattcag
aactactatacaagtcgtcggcagaagtctgagcgctcacccagagggaagtggaaccac
gactgcttgatgattgatggattagtctctcaactaggagatgaagttgagaagttgtgg
aagcgggacgaaggtggcacaggaagataccctcctgctagcatccacgcattacttgat
atatatttattagacaacattaccgaagcaagcaaacatgctattaccatttatttgctg
cttgatattatgtattcctttccaaataaaacggatacccccattgaatctttcccaact
gcctttgctatttcttggggccaagttaagctagttcaaggattttggctgctagatcat
aatgactatgagaatggtttagaccttctgtttcacccagttactgcaaagcctgcatcg
tggcaacattcaaagataattgaagcttttatgagtcagggagagcacaaacaggctctc
cggtatcttcagacaatgaagccaacagtgtccagtagcaatgaagttatccttcacctc
actgttctactttttaatagatgcatggttgaggcctggaacttactgcgacagaattca
aacagagtaaatatagaggaattattaaagcacgcttatgaagtttgtcaggagatgggc
ttaatggaggatttactgaagctgccatttacaaacactgagcaggaatgcttagtgaaa
tttttacagtccagtaccagtgttgagaatcatgaattccttctagttcaccatttacag
cgtgccaattatatttctgccttgaaactaaaccagattctgaagaataatctcatgagt
gatcgtgaccctcgattgcgggaaagatcggtgactcgaaattctatattagaccagtat
gggaaaatcctacctagagtccagagaaagttagctgttgagcgagctaagccttaccac
ctgtcgacatcctcagtttttcatgaagtttctagacccaaaccgttatcggcatttcca
aagaaagctataactggaacagtgttaacccgatctacgttcatcagcaatgttttatct
aaaattggagaggtgtgggcaagtcatgagcctagaaatggcgtctcactttttaacagt
cctaaaacagaacagccatctcctgtagtacactctttcccacacccagagcttcctgag
gcgtttgttggaactccaatttcaaatacatcccagagaatttctagattactggatttg
gttgtccatcctgtaccccagccttctcagtgtttggagtttattcaacaaagtcccaca
agatctcctttgtgtctgctgtccagttcgttaccattaagttcacagtttaaaaggcca
catcagaatacctccaggccttcagagttgcttttacttgagactcctctcatagttaag
aaagctaaatctttggctctgtcagccacgtcttctggatttgccgagtttactcctcca
tccatccttaggtctggttttcgaacaacacctttagcatctccctctttgtcacctgga
agatctctcactccgcctttcagagttaaagaaacaaggatttcattcatggaagaaggc
atgaatacacactggactgatagagctacagatgaccgaaatacaaaagcgtttgttagc
acatctttccataaatgtggacttccagcagaaactgagtggatgaagaccagtgataag
aatacatattttcctctggatgtccctgcaaagggccctcagaaagtggtggcagagtca
ctggctacccattcaggaaggctggagaaactggatgtgagcaaagaagacagcacagct
tccaccaggtcagaccagacctccttagagtatcatgacgcaccatcaccagaagacttg
gaaggtgctgtttttgtgtctcccaagccagcatcttcctccactgaactaactactaat
tcaactctacaaacagagagggataatgataaagatgcgtttaagtcagaaggtgctcct
tcacccgtgaagaaacaaataggcacgggagatgctgcagtggaagcattttcagaactg
agtcgcttagaccctgttgaaagagctgaagcttcttttgctgtgtcgtcagtctgtgaa
ggggaaacctccacttcaaactccaagacgtcagttctggatggaatcgtgcctattgag
agccgaacctccatacttacagcagaccacaaagagtctgtggccaacacggttgcagat
gttgaaagctctgggtccaccagctccaagtgcccggttacctctgaacgcagcctcggc
caaaaactaacattaaacttaaaagaagatgaaatagaagctcatgtaccaaaggagaac
gttggtttaccagaagaaagccctcgaatttctgctgctccttctgatactcacgagatt
catctaattggatgtgaaaatcttgaagttcaaaattcagaagaggaggccaagaatctt
tcatttgatgagttgtatcccttaggggcagagaaacttgagtataatctcagtactatt
gagcagcagttttgtgacttgcctgatgacaaagactctgctgaatgtgatgctgctgaa
gtagacggggaactttttgtggcccagagcaactttaccctgattttagaaggtgaagaa
ggagaagctgaggcaagcgactctgcagcacctaatatgttaccgaaagcgaccaaggaa
aaacctgtgtgccacagggaaccccataatcaggagcgcgttacagatttgccatctgct
gtgactgctgaccaagaatcccacaaggtagagactttaccgtatgtgcctgaaccggtt
aaagtggcaattgcagaaaatctgttggatgtaattaaagacaccagaagtaaggaagca
actcccgtggcagcaggtgaggctggtgatgaggacggagcagtgatagtctcaaaggct
gcacattcgtccaggctgacaaactctacaccgaagactgttaaggaaccacatgcagag
actgtaaataccagccagaatgatgacatggtttcttctagaactctcacaagaaggcag
catgccctaagcctgaatgtcacatcagaacaagagccttcagcagttgccactcctaag
aagagaactagaaaaattaaagaaactcctgagtcttctgaaaggacctgttctgaccta
aaagtagcacctgagaaccaactgacagctcagagtcctcccgctcctaggagaggaaag
aagaaggacgttagccaaggcacactgccaagttctggtgctgtggagccggagccggaa
cctcagggtacgccgggaagactgaggctgagaacgcagccacccgagccagcagctgaa
gaaactccttctagaacaaaagtcaggctttcatctgttagaaagggaacccctagaaga
cttaagaagtctgtagaaaatgggcaaagtacagaaattctagatgatctcaaagggagt
gaggcagcaagtcatgacgggactgtcacagagctgaggaatgccaatttagaagatact
cagaatatggagtataaacaagatgaacacagtgaccagcaactgcctctaaaacgaaag
agggtcagagagagagaagttagtgtgtcaagtgtgacagaagagccaaagcttgactca
tcccagttgcctcttcagacaggactcgatgtacctgccacccctaggaaacgtggtaga
cccaggaaggtagttcccttagaagctgatggtggcacaactggtaaggaacagacaagt
cctcagaagaaagatgttccggttgtccggagatctacacggaacaccccagctagaaat
gtgagtactttagaaaaatcagttttagtgccaaataaggaagctgctctagtggtgaca
tctaagaggagacctacaaagaagtctgcagaggaaagctcaaaagatccatcagcggca
gtctcagacctggcgggtggagcagcccacacagagtccgctgaccgaagggacggactg
cttgccgccgctgctctcacgccatctgcccagggcacaaggactaggtctagaaggacc
atgttgttgacggacatttctgaacccaaaactgagcctttatttcctcctccttcagtg
aaggttccaaagaaaaaatcaaaagctgagaacatggaggccgcagcccagctgaaagaa
ttggtgtcagatttatcttctcagtttgttgtttcccctcctgccttgagaaccaggcag
aaaagtatatccaatacttccaagcttctaggtgaactggagagtgaccctaaaccatta
gagatcatagaacaaaaaccaaaaagaagcaggactgtgaagacaagagcaagcagaaac
acaggaaaaggaagttcttggtcacctcctcctgtagaaattaagctggtttctcccttg
gcgagtccagtggatgaaataaagaccggcaagccaagaaaaactgcagaaatagcagga
aaaactcttggaaggggcagaaagaagccatcttcttttccaaagcaaattttacgcagg
aaaatgctgtaa

DBGET integrated database retrieval system