KEGG   Mus musculus (mouse): 226777
Entry
226777            CDS       T01002                                 

Symbol
C130074G19Rik
Name
(RefSeq) RIKEN cDNA C130074G19 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4710
Other DBs
NCBI-GeneID: 226777
NCBI-ProteinID: NP_848807
MGI: 2444831
Ensembl: ENSMUSG00000039349
Vega: OTTMUSG00000029896
UniProt: Q8BGN9
Position
1:complement(184604123..184615233)
AA seq 141 aa
MTVGARLRSKAASSLVGRRPLGRSRRAGDEETDAIVEHLEGEDEDPASPDCEREEGGRRA
GTPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNFGKAISKGCRYIVIGLQ
GFAAAYSAPFGVATSVVSFVR
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacggtgggcgcccggctccgaagcaaggcggcgagcagcttagtgggccgaaggccc
ctggggcgatcgcgccgcgccggtgacgaggagacagatgccatcgtggagcacctggag
ggcgaggacgaggacccggcgagcccggactgtgagcgcgaagagggcgggcggcgcgcg
gggactccgagcgcacgcagggtgcacctggctgcgctgcctgagcgctacgactccctg
gaggagcccgcgccaggcgacaagcccaagaagaggtaccggcgaaaactgaagaagtac
ggcaagaattttgggaaggccatcagcaaaggatgccggtacattgtcattggcctgcaa
ggatttgccgcagcgtactccgccccatttggagtggccaccagcgtggtgtcctttgtg
cgctaa

DBGET integrated database retrieval system