KEGG   Mus musculus (mouse): 226856
Entry
226856            CDS       T01002                                 

Symbol
Lpgat1, AI649174, AW112037, BC013667
Name
(RefSeq) lysophosphatidylglycerol acyltransferase 1
  KO
K13514  lysophosphatidylglycerol acyltransferase 1 [EC:2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    226856 (Lpgat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    226856 (Lpgat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     226856 (Lpgat1)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   226856 (Lpgat1)
SSDB
Motif
Pfam: Acyltransf_C Acyltransferase
Other DBs
NCBI-GeneID: 226856
NCBI-ProteinID: NP_758470
MGI: 2446186
Ensembl: ENSMUSG00000026623
Vega: OTTMUSG00000021870
UniProt: Q91YX5 Q3UZK0
Position
1; 1 H6
AA seq 370 aa
MAVTVEEAPWLGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGL
MYKWLLGMVASWGWYAGYTVMEWGEDIKAIAKDEAVMLVNHQATGDVCTLMMCLQDKGPV
VAQMMWLMDHIFKYTNFGIVSLIHGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRKWIV
LFPEGGFLRKRRETSQAFAKKNNLPFLTHVTLPRFGATNIILKALVARQENGSPAGGDAR
GLECKSRGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIGDVPLETEDLT
SWLYQRFIEKEDLLSHFYKTGAFPPPQGQKEAVCREMTLSNMWIFLIQSFAFLSGYLWYH
IIQYFYHCLF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggccgtgaccgtggaagaagctccgtggctgggctggattgtagcgaaagccctgatg
agatttgccttcatggtcgccaacaacctggtcgctattccatcctacatctgctatgta
attatactgcagccactccgagtgctggacagtaagcgcttctggtatatcgaaggactc
atgtacaaatggcttttaggaatggtggcttcctggggctggtatgctggatacacagtg
atggaatggggggaagatattaaagcaatcgctaaagatgaagcagtgatgttggtgaac
caccaggcaactggagatgtgtgtacattgatgatgtgcctacaggataaaggaccggtt
gtcgctcagatgatgtggctgatggatcatattttcaagtatacaaactttggaattgtt
tctcttattcatggagacttctttataagacagggaagagcctaccgcgaccaacagctg
ctggttctcaagaagcaccttgaacataattacaggagcagagatcgaaaatggatcgtt
ttgtttccggaagggggcttcctcaggaagaggcgagaaacaagccaggcatttgccaag
aaaaataacttgccatttcttacacatgtcactttgccaaggtttggggcaacaaacatt
attttgaaggcacttgtagcacggcaggaaaatggaagcccagcaggaggagacgctaga
ggcttagaatgcaaatcaagaggcctccagtggataatagatacaaccatagcttatccc
aaagctgaaccaatagacattcagacctggatcctggggtacaggaaaccaacagtcact
catgtccattacaggattttcccaattggagatgtgcccttggagaccgaggacctcacc
agctggctctatcagcgctttattgagaaggaggacctcctgtcccatttttataagaca
ggagcctttcctcctccccagggccagaaggaagctgtgtgcagagagatgaccctcagc
aacatgtggatattcctcatccagtcctttgcgtttttgtcaggctatctgtggtaccac
atcattcagtatttttaccattgtctattttag

DBGET integrated database retrieval system