KEGG   Mus musculus (mouse): 22693
Entry
22693             CDS       T01002                                 

Gene name
Zfp30, 2610306P15Rik, Zfp-3, Zfp-30
Definition
(RefSeq) zinc finger protein 30
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22693 (Zfp30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22693 (Zfp30)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22693 (Zfp30)
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 C1_4 DUF3268 DUF5830
Other DBs
NCBI-GeneID: 22693
NCBI-ProteinID: NP_038733
MGI: 99178
Ensembl: ENSMUSG00000047473
Vega: OTTMUSG00000022380
UniProt: Q60585 Q78FW7
Position
7 B1; 7 17.26 cM
AA seq 548 aa
MILEEEQASSCDSGIMAHSTVMFRDVAVGFSQEEWECLSAYERDLYRDVMLENYSHLVSL
AGCSISKPDVITLLEQGKEPWMIVRAEKRRWSRDLESRYSSNGLLPEKNTYEINLSPWEI
MGRIQRRGPEDSLLGKDFEYKIYEEQENSHRVYFRHVIKTTSGKRPRYRKRTPVSLYQKT
PNGEKPYECGECGKAFKVRQQLTFHQRIHTGEKPYECKECGKAFRQCAHLSRHQRIHASD
KLYECKKCAKIFTCSSDLRGHQRSHVGEKPYDCKECGKAFRVRGQLMLHQRIHTGEKPYA
CTECGKSFRQVAHLTRHQRLNSGSSRHECKECGRAFLCSTGLRLHHKLHTGEKPYDCKEC
GKAFRVRQQLTLHERIHTGEKPFDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECRKFF
RRYSELISHQGIHIGEKPYDCKECGKAFRLFSQLTQHQSIHFGEKPYKCMECEKTFRLLS
QLTQHQSIHTGEKPYDCKECGKAFRLHSSLIQHQRIHSGEKPYKCTECKKAFRQHSHLTY
HQRIHKNL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgatcctcgaggaagaacaagccagttcttgcgattctggaatcatggctcatagtacg
gtgatgttcagagatgtggctgtgggcttttctcaggaagagtgggagtgcctgagtgcc
tacgagagggatctgtacagagatgtgatgctagagaactacagccacttggtgtcactg
gcaggatgttccatttctaagccagatgtgatcaccctgttggaacaagggaaggagccg
tggatgattgtgagggctgagaagagaaggtggagccgagatctggaatccagatacagc
agtaacgggttacttccagaaaagaatacttacgaaattaatctatctccgtgggaaata
atgggaagaattcaaaggcgtggccccgaagactcccttttggggaaagactttgaatat
aaaatatatgaagaacaagagaactctcatagggtatatttcagacacgtgataaaaacc
acctctggaaaaagacctcggtacagaaaacgcacacctgttagtctctatcagaaaact
cctaacggagaaaagccctacgaatgtggggagtgtgggaaggctttcaaagtccgccaa
caacttactttccatcagaggatccacaccggcgagaagccctacgaatgcaaggaatgt
ggcaaagccttccgacagtgcgcccacctcagtcgccatcagaggatccacgcctctgac
aagctctatgaatgtaagaagtgtgcaaagatcttcacgtgtagctcggaccttcgaggg
catcagaggtctcacgtgggcgagaagccctacgattgtaaagagtgcgggaaggccttt
cgagtccgtggacagctcatgctccaccagaggatccacaccggtgagaagccctacgca
tgcacggagtgcggcaagagcttccggcaggtagcgcacctcactcggcatcagaggctc
aacagtggcagctcacgccacgagtgtaaggagtgcggccgggctttcctgtgcagcacg
ggcctccggctgcatcacaaactgcacacgggagagaaaccctacgactgcaaggagtgt
gggaaggcgttccgggtgaggcagcagctcaccctgcacgagaggatccacaccggcgag
aagcccttcgactgcaaggagtgcgggaagaccttcagccgcggctaccatctcaccctc
caccagaggatccacactggggagaagccttacgagtgtaaggagtgccgcaagttcttc
cgccggtactcggagctcatttcccaccagggcattcacatcggggagaaaccctatgac
tgcaaggagtgcggaaaggcttttaggctgttctcccagctgactcagcaccagagcatt
cattttggtgagaagccctataaatgtatggaatgtgagaagactttcagactcctctca
caactgacgcagcatcagagcattcacacgggcgagaagccttacgattgtaaggagtgc
gggaaagcctttcgcctccactcgtctctcattcagcaccagagaatccactctggcgag
aagccgtacaaatgtacggagtgtaagaaggccttccgtcaacactcacacctcacctac
catcagcgaattcataagaatttgtaa

DBGET integrated database retrieval system