KEGG   Mus musculus (house mouse): 22697
Entry
22697             CDS       T01002                                 
Symbol
Zscan21, AI326272, CTfin51, RU49, Zfp-38, Zfp38, Zipro1
Name
(RefSeq) zinc finger and SCAN domain containing 21
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22697 (Zscan21)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22697 (Zscan21)
SSDB
Motif
Pfam: zf-H2C2_2 SCAN zf-C2H2 zf-C2H2_4 zf-C2H2_11 zf-C2H2_jaz zf_UBZ Zn-ribbon_8 zinc_ribbon_15 zf-C2H2_6 DZR DctP zf-AN1 zf-met
Other DBs
NCBI-GeneID: 22697
NCBI-ProteinID: NP_001038168
MGI: 99182
Ensembl: ENSMUSG00000037017
UniProt: Q07231
Position
5:138115161..138132527
AA seq 555 aa
MTKVVGMATVLGPRPPQESMGPSPIKVEEDEEKDKCCPTLELSHKHFRQSGNQDTLEPMG
PSTIKAEEDESKDKCRPNLEISRKSFKQFGYQDTLEQLGPSTIKAEEDDEKDKGHPSPEI
SRQRFRQFGYHDTPGPREALSQLRVLCCEWLQPEIHTKEQILELLVLEQFLTILPRELQT
WVQQHCPESAEEAVTLLEDLEQELDEPGLQVSSPPNEQKQSWEKMSTSGTAMESLSSTET
QHVDASPKYEFWGPLYIQETGEEEVFTQDPRKRQGFKSNPQKEDSADEHRSSEEESHADG
LKRTVIPMIPANKYGSRSERQWANNLERERGTKASLQDTGSRKGAEPASTRPAPGEKRYI
CAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCG
KAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFS
QHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCSHCGKTFCSKSN
LSKHQRVHTGEGEVQ
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgactaaggtggtgggcatggccacagttctgggccccaggccacctcaggaatctatg
ggaccttcgcccattaaagtagaagaggatgaagagaaagacaagtgctgccctacccta
gagctatcccataagcacttcagacagtctgggaaccaagatacccttgagccaatgggt
ccttcgaccattaaagctgaagaggatgaaagcaaagacaagtgccgccctaacctagag
atatcccgtaagagcttcaagcagtttgggtaccaagacactcttgagcagttgggacct
tcgaccattaaagctgaagaggatgatgagaaggataagggccaccctagcccagagata
tctcgacagcgcttcaggcaatttgggtaccatgacactcctgggccccgagaggcactg
agccagcttcgggtgctctgctgtgagtggctacagcccgagatccacaccaaagagcag
attctagagctactggttctggagcagttcctgaccatcctgccccgagagctccagacc
tgggtacagcagcactgccctgaaagtgcagaggaggccgtcactctcctggaagacctg
gagcaagaacttgatgagccaggactgcaggtctcatctcctccaaatgaacagaagcag
tcttgggagaaaatgtcaacttcaggaacggcaatggagtccttaagcagtactgagacc
caacatgtggatgccagccctaaatatgagttttgggggcccctgtacatccaagagact
ggtgaggaggaggtttttactcaggatccaagaaagcgccaaggttttaaatcgaatccc
cagaaggaggactcagcagatgagcacagaagttctgaagaagagtctcatgcagacgga
ctcaaaagaaccgtcatccccatgattcctgccaataagtatgggtcacggtcagaaagg
cagtgggccaacaacctggagagggagagagggacaaaagcctctcttcaagacacaggt
tccaggaaaggggcagagccagcgtctactaggcctgccccaggagagaaacgttacata
tgtgcagagtgtgggaaggcctttagcaatagctcaaacctcactaagcaccggagaaca
cacactggggagaagccttatgtgtgtacaaagtgtgggaaggctttcagccacagctcc
aaccttacccttcattaccgaactcacctggtggaccggccctatgactgtaagtgtggg
aaagcctttgggcagagctcagacctccttaaacatcaaaggatgcacacggaagaggcg
ccctatcagtgtaaagactgtgggaaagcctttagtgggaagggcagcctcattcgacac
tatcgcatccacacaggggagaagccctatcagtgtaatgagtgtggaaagagttttagt
cagcatgcaggtctcagttctcatcagcgtctgcatacaggggagaaaccctataagtgt
aaggagtgtggcaaagccttcaaccatagttcaaattttaataagcatcatagaatccat
actggcgaaaagccctattggtgtagccactgtgggaaaaccttctgtagcaagtccaat
ctgtccaagcatcagagagttcacactggagagggagaagtccagtaa

DBGET integrated database retrieval system