KEGG   Mus musculus (mouse): 226976
Entry
226976            CDS       T01002                                 

Symbol
Kansl3, 4632411B12Rik, 4932435K23, AI431067, AI647574, C85723, Kiaa1310, mKIAA1310
Name
(RefSeq) KAT8 regulatory NSL complex subunit 3
  KO
K16719  regulatory NSL complex subunit 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    226976 (Kansl3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     226976 (Kansl3)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     226976 (Kansl3)
SSDB
Other DBs
NCBI-GeneID: 226976
NCBI-ProteinID: NP_001297442
MGI: 1918055
Ensembl: ENSMUSG00000010453
Vega: OTTMUSG00000049477
UniProt: A2RSY1
Position
1; 1 B
AA seq 903 aa
MAHRGGERDFQTSARRMGTSLLFQLSVHERELDLVFLDHSYAKPWSAHPDASSARPTRML
FVTPRRQQENTIESDVPIDVETVTATPVPLYDNQKARSVMNECERHVIFARTDADAPPPP
EDWEEHVNRTGWTVAQNKLFNKILKALQSDRLARLANEGACNEPVLRRVAVDKCARRVRQ
ALASVSWDTKLTQWLHTTLVETLSLPMLAAYLDALQTLKGKIPTLIDRMLVSSNTKTGAA
GAEALSLLLKRPWDPAVGVLSHNKPSKLPGSPLILIVSSGPSSSVFPASRRHRFWQSQLS
CLGKVIPVATHLLNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVA
CHVSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFR
EKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHVG
SEPRDQDAEKKKKPRDLTRRDLAFEIPERGSRPASPAARLPTSPSGSEDLSSVSSSPTSS
PKTKVTTVTSTQKSSQIGTSQLLKRHVQRTEAVLTHRQAQAQFAAFLKQNMLVRKAFPPG
TSSCLFVPISSESVEDIEKEELRVQLKRHHSSSPLPGAKPSKRPKIKVSLISQGDTVGGP
CTLSQGGTPEAAGGKPITMTLGASAGAKELTGLLTTAKSSSSEGGGTASTTPSVASSSAT
PNAIHTLQSRLVATSPGSSLPGTASASSLLQGLSFSLQDISSKTSGLPGSPSPGPAPQAT
SVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGSLAKLASS
LPGLAQISNQASGLKVPTTITLTLRGQPSRITTLSPMGSGATPSEEPNSQMLPSSSQRLP
PAP
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggcccaccggggtggggagagggacttccagacttcagctcggcggatgggtacctcc
ctgctcttccagctttcagtgcatgagcgggaactggacctcgttttcctggatcatagc
tatgcaaaaccgtggagtgcccacccagatgccagtagtgcccgccccacccgcatgctc
tttgtaaccccccgtcggcagcaggagaatactattgagtcagacgttccaatagatgtg
gagacggtcacggcaactcctgttccactttatgacaatcagaaggcaagaagtgtgatg
aacgagtgtgaacggcacgtgatcttcgccaggacagatgcagatgctcctcctccgcca
gaagactgggaagaacatgtcaacaggactggctggacagtggctcagaataagctattt
aacaagatcctcaaagccctgcagtctgaccggcttgcacgattggccaatgaaggggct
tgcaatgagcctgtgctgcgtcgcgtggctgtggacaagtgtgcaaggagggtgcggcag
gcgctggcaagtgtcagctgggacaccaagctgacccagtggctgcacaccaccctcgtg
gagaccctgagcctgcccatgctggctgcttacttggatgccctgcagacactgaaaggg
aagatcccaactttgatagatcggatgcttgtgtcgtccaacaccaaaactggggctgca
ggagcggaggccttgtcccttctcctcaagaggccctgggaccctgctgttggtgtgctt
tcacataacaaaccaagcaagctccctggttctcctttgattctcatcgtctcctctggt
ccctccagctctgtgttccctgcctcacgccgccaccgcttctggcagtctcagctctcc
tgcttaggcaaggtcatccctgtagcgacccatctactgaacaatggcagtggggtagga
gttctgcagtgcctcgaacacatgattggggccgtgagaagcaaagtgctagagattcac
agccatttcccacacaaacccatcatcctgattggatggaatacgggagctttggtggcc
tgtcatgtgtctgtgatggagtacgtcactgctgttgtctgccttgggtttcctctgctt
actgtggatggacccaggggggatgtggacgatcccctcctggacatgaagactccagtc
ctcttcgtcattggtcagaattctctacagtgtcaccctgaagccatggaggacttccgg
gaaaagattcgagcagaaaatagcttggtggtggttgggggagctgatgataatctcaga
ataagcaaagcaaagaagaaatcagagggcctgactcagagcatggtggacagatgtatt
caggatgagattgtagacttcctgactggagtgctcactcgtgctgagggtcatgtgggc
tctgagcctcgggatcaggatgctgagaagaagaagaaaccccgggacttgacccgaaga
gacctggcctttgaaattcctgagcgaggcagtcgtcctgcttccccagctgccaggctc
cccacatccccctcaggctcagaggatctctccagtgtgtccagcagccccacctctagc
cctaagaccaaagtgaccacagtgacctctacccagaaatcaagtcagattgggacctcc
cagctgctgaaaagacatgtgcagaggacagaagctgtgctgacccacagacaagcccaa
gcacagtttgctgcttttctgaaacaaaacatgctggtgaggaaagcttttcctcctggc
acctcctcctgtctctttgttcccatttcatcagaatcagtggaggacatagagaaagaa
gagcttcgggtccagcttaagaggcaccattcttccagtcctcttcctggagcaaagcct
tccaagcgaccaaagatcaaagtgtccctgatctcccaaggggacacagttggaggacct
tgcactctttctcaaggtggaacacctgaagctgccggagggaagcccatcaccatgacc
ctgggagcttcagcaggagccaaggaactcactggacttctcactacagccaagtcaagt
tcttctgaaggtggaggtacagccagcacaaccccatctgtggcttccagcagtgccaca
cctaatgctatccacacgctgcagagccgcttggtggccacttctccaggcagctccctt
ccagggaccgcttcagccagcagcctcctccagggcctcagcttcagcttacaggatatt
agcagcaagacctctggcctcccaggaagtccctccccagggccagccccacaggccacc
agtgtgaaattgccaacccccatgcagagtctgggtgccatcaccacaggcacgagcacc
attgtccgtaccatccctgtggccaccactctctcctccttgggtgccactcctggtggg
aagcccactgccatccaccagctgctgaccaatgggagcctcgctaagttggcaagcagc
ctacctggcttggctcagatttccaaccaagcatcaggcttaaaggtccccaccaccatt
actctgacgctgcgtggccagccaagcagaattaccacgctaagccctatggggtcaggg
gcaacgccgtccgaggagcccaactcccagatgctaccatctagttcacagcgcctgcct
ccagcaccctga

DBGET integrated database retrieval system