KEGG   Mus musculus (mouse): 226982Help
Entry
226982            CDS       T01002                                 

Gene name
Eif5b, A030003E17Rik, BC018347, IF2
Definition
(RefSeq) eukaryotic translation initiation factor 5B
  KO
K03243  translation initiation factor 5B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    226982 (Eif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    226982 (Eif5b)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-5
    226982 (Eif5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU IF-2 GTP_EFTU_D4 GTP_EFTU_D2 MMR_HSR1 Roc ATP_bind_1
Motif
Other DBs
NCBI-GeneID: 226982
NCBI-ProteinID: NP_938045
MGI: 2441772
Ensembl: ENSMUSG00000026083
Vega: OTTMUSG00000049483
UniProt: Q05D44 Q6A002
Position
1; 1 B
AA seq 1216 aa AA seqDB search
MGKKQKNKSEDSTKDDTDLGALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDENDILR
ELEELSLEAQGIRADRDAAAVKPTENNEEESASKQDKKKKGQKGKKTSFDENDSEELEDK
DSKSKKTARPNSEAPLSGSEDADDSNKLSKKGKKAQKSTKKRDGSEEDEDNSKRSKERSR
VNSSGESGGESDEFLQSRKGQKKNQKNKSVPTVDSGNEDDDSSFKIKTVAQKKAEKKERE
KKKRDEEKAKLRKMKEKEELEKGKKEQSKQREPQKRPEEEVLTLRGTPDTGAASEEKGDT
AAALEDDNEGDKKKKDKKKKKTEKDEKEKEKKKGPSKSTVKAIQEALAKLKEEEERQKRE
EEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEV
TLRHLQAQGVEVPSKDSLPKKRPVYEDKKKKKTPQQLESKEVSETLEISAPVEAVDQGGP
EKEETPPSVEPEEEEDTEDAGLDDWEAMASDEEREKEGNMIHIEVEENPEEEEEEEEEEE
EEESEDEEEEGDSEGSDGDEEDCKLSDEKDSGKAGDTKPSKDASSDSEYDSDDDRTKEER
AYDKAKRRIEKRRLEHGKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGI
TQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAI
LVVDIMHGLEPQTIESINILKSKKCPFIVALNKIDRLYDWKKSPDSDVAVTLKKQKKNTK
DEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQT
MLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQIRGL
LLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKDDEIPVLKDELI
HELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVM
LEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEF
KHIAVFPCKMKILPQYIFNSRDPIVIGVTVEAGQVKQGTPMCVPSKNFVDIGIVTSIEIN
HKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQK
SDWQLIVELKKVFEII
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaacagaaaaacaagagcgaagacagtaccaaggatgatactgatttgggc
gccttggctgcagaaatagaaggagctggtgctgccaaggagcaggagcctcagaagtca
aagggaaagaagaaaaaggagaaaaagaaacaagactttgatgagaacgacattctgaga
gagctggaggagttgtctctggaagcccaaggcatcagagctgacagagacgccgctgca
gtcaagcctacagaaaacaatgaagaagaatctgcctcaaaacaagataaaaagaagaag
ggacaaaaaggcaagaaaacaagttttgatgagaatgatagtgaagaattggaagataaa
gattcaaagtcaaaaaagactgccagacctaactcagaggcacccctttctgggagtgag
gatgctgatgattctaataaactttctaaaaaaggtaaaaaagcccagaaatccacgaaa
aaacgggacgggtcagaagaggatgaagacaatagcaaaagaagtaaagaacgttcgaga
gtaaactcctctggtgaaagtggtggtgagtccgatgaatttttgcagtccagaaaagga
cagaaaaaaaatcagaagaacaagtccgttcctaccgtagacagtgggaatgaggacgat
gactcttccttcaaaattaagacggtggcccagaagaaggcagaaaagaaagagcgcgag
aagaaaaagagagatgaagagaaagcgaagttgcggaagatgaaggagaaagaagagcta
gagaagggcaagaaggagcagagtaaacagagggagcctcagaagagacctgaggaggag
gtgttgacactcagagggactcctgacacaggagctgcctcggaagagaaaggagacact
gctgcagctctggaagacgacaatgaaggagacaaaaagaaaaaagataagaagaaaaag
aaaacagagaaagatgagaaagaaaaagagaagaagaaaggccctagtaaatctactgtt
aaagctatccaggaagctttggctaagctcaaagaggaggaggagagacagaagagagag
gaggaagaaaggattaagcggcttgaggagcttgaagccaaacgaaaagaagaggaacga
ttagaacaagaaaaaagagaaaggaaaaagcaaaaagaaaaagaaagaaaagaacggtta
aaaaaagaaggaaagctgttaactaagtcccagagagaagccagagccagagccgaagtg
acccttagacacctccaagctcagggtgttgaagtgccatcaaaagactcgttgccaaag
aaaaggccagtttatgaagataagaagaagaagaaaacaccacagcagctagagagtaaa
gaagtatctgaaactttggaaataagtgctcctgtggaagctgtggaccaaggaggacca
gaaaaggaagagacgccaccttctgttgagccagaggaagaggaagacaccgaagatgct
ggcttagatgactgggaggctatggccagtgatgaggagagagaaaaagaaggaaatatg
attcacatagaagtagaagaaaaccctgaggaagaagaagaggaagaagaagaggaggag
gaagaagagagtgaagatgaagaagaggaaggggacagtgaaggcagcgatggggacgag
gaggactgcaagctgtcggatgagaaggactcagggaaggctggagacacgaagcccagc
aaagacgctagctcagactccgagtacgactccgacgacgatcggactaaagaagagcgg
gcgtacgacaaagcgaaacggaggattgagaaacgacgacttgaacatggtaaaaatgta
aatacagaaaagctgagagcccctatcatctgtgtgcttggacatgtagacacaggaaag
acaaaaattctagataagctccgtcacacacatgtgcaagatggcgaagcaggtggtatt
acacagcagattggtgccacaaatgttcctcttgaagctattaatgaacaaactaagatg
attaaaaattttgacagagagaatgtccgaatcccagggatgctgattattgatactcct
ggacacgagtctttcagtaacctgagaaacagaggaagctctctttgtgacattgccatt
ttagttgttgacattatgcatggtttagagccccagacaattgaatcaatcaacattctc
aaatctaaaaagtgccccttcattgttgcacttaataagattgacaggttatatgattgg
aagaagagtcctgattctgatgtggctgttactttaaaaaagcagaagaagaatacaaag
gatgaatttgaggagcgtgcaaaggccattattgtagaatttgcacagcagggtttgaat
gctgctttgttttatgagaataaagatccccgcactttcgtgtccttggtacctacctct
gcacatactggtgatggcatgggaagtctcatctaccttcttgtggagttaactcaaacc
atgttgagcaagaggcttgcacactgtgaagagctgagagcacaagtcatggaggttaaa
gctctcccaggaatgggcaccacaatagatgtcatattgatcaatggacgtttgaaggaa
ggggatacaatcattgtccctggagtagaagggcccattgtcactcagattcgaggcctc
cttttacctcctcctatgaaggaattacgtgtgaagaaccaatatgaaaagcataaagaa
gtggaagcggcccagggagtaaagattcttgggaaagaccttgaaaaaaccctggctggc
ttacctctcctagtggcctacaaggatgatgaaatcccagttctcaaagatgaattgatc
catgagttaaagcagacactaaatgctatcaaactagaagaaaaaggagtttatgtccag
gcatctacactgggctctttggaagctcttcttgaatttctgaaaacatcagaggtgcca
tatgcaggaattaacattggcccagtccataaaaaggacgttatgaaggcttcagtgatg
ttggaacatgatccccagtatgcagtaattttggcctttgatgtaagaattgaacgggac
gcacaagagatggctgatagtttgggagttagaatctttagtgcagaaattatttatcac
ttatttgatgcctttacaaaatacagacaggactacaaaaaacaaaaacaagaagaattt
aagcacatagcagtatttccctgcaagatgaaaatcctccctcaatacattttcaattct
cgagatccaatagtaataggggtcactgtggaggctggtcaagtgaaacaaggaacacct
atgtgcgttccaagcaaaaattttgttgacattgggatagtaacaagcattgaaataaac
cacaagcaggtggatgttgcaaaaaaaggacaagaggtctgtgtcaaaatagaacctatc
cctggggaatctcccaaaatgtttgggagacattttgaagctacagatatacttgtcagc
aagatcagccggcagtccatcgatgcactcaaagactggttcagagacgaaatgcagaag
agtgactggcagcttattgtggagctgaagaaagtatttgaaatcatctaa

DBGET integrated database retrieval system