KEGG   Mus musculus (mouse): 22702
Entry
22702             CDS       T01002                                 

Symbol
Zfp42, Rex, Rex-, Rex-1, Rex1, Zfp-4, Zfp-42
Name
(RefSeq) zinc finger protein 42
  KO
K11516  zinc finger protein 42
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99998 Others
    22702 (Zfp42)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_11 IBR XPA_N
Other DBs
NCBI-GeneID: 22702
NCBI-ProteinID: NP_033582
MGI: 99187
Ensembl: ENSMUSG00000051176
Vega: OTTMUSG00000061169
UniProt: P22227 E9QK22
Position
8 A4; 8 23.89 cM
AA seq 288 aa
MNEQKMNEQMKKTAKTSGQKGPGGRALDRLTLKQDEARPVQNTRVEAPRVTYTIRDESEI
SPETEEDGFPDGYLECIIRGEFSEPILEEDFLFKSFESLEEVEQNLSRQVLEASSLLESS
LEYMTKGTKQEKREVTQETPPLRVGASSLLAGGPAEKPEGGVYCGVLSMLECPQAGCKKK
LRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSL
DFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAKAGKKC
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaatgaacaaaaaatgaatgaacaaatgaagaaaacggcaaagacaagtggccagaaa
gggccgggcggaagagccctcgacagactgaccctaaagcaagacgaggcaaggccagtc
cagaataccagagtggaagctccccgtgtaacatacaccatccgggatgaaagtgagatt
agccccgagactgaggaagatggcttccctgacggatacctagagtgcatcatacgaggt
gagttttccgaacccattctggaagaggatttcctttttaaatccttcgaaagcttggag
gaagtggagcaaaacctttctcgccaggttctggaagcgagttcccttctcgagtcttct
ttggagtacatgacaaaggggacgaagcaagagaagagagaggtcacgcaagagacgcct
ccgctgagggttggggcgagctcattacttgcaggcggccctgcagagaagccagagggc
ggtgtgtactgtggtgtcttatcgatgctggagtgtcctcaagccgggtgcaagaagaag
ctgagggataaaaccgccctgaggaagcacatgcttgtccacgggccccggcggcacgtg
tgtgcagagtgtggcaaagccttcacggagagctcgaaactaaagcgacattttctggtg
cacaccggagagaagccgtatcagtgcacgttcgaaggctgtgggaagcgcttctccctg
gatttcaacttgcgcacccatatccgcatccacaccggggagaggcgctttgtgtgtcct
tttgatggctgcgagaagagctttattcagtcaaataaccagaagattcacatcctaacc
cacgcaaaggccgggaagaaatgctga

DBGET integrated database retrieval system