KEGG   Mus musculus (house mouse): 227094
Entry
227094            CDS       T01002                                 
Symbol
Nemp2, 5330401P04Rik, 9830163O08, Tmem194b
Name
(RefSeq) nuclear envelope integral membrane protein 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NEMP
Other DBs
NCBI-GeneID: 227094
NCBI-ProteinID: NP_001136119
MGI: 2444113
Ensembl: ENSMUSG00000043015
UniProt: Q8CB65
Position
1:52669850..52691078
AA seq 421 aa
MLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQI
QWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFIKCVTHNFWAPEEAEEITIVF
SPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVTGIFLFLYAKTLSQSPVFYYSS
GTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVLCQLMEDLKWLWYGNRMYI
LGYVVVVGLCSFAACYSHGPLADEGSRDLLMWTLRLFSLALVYTGVAAPQFAYAVLIVLL
FSWSLHYLLRAFSYLRWKMRPWFTAEPQVARYLTDDEYREQAEAATARALEELRQACCRP
DFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPA
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgctgcctaggttgtggtggctggtgctctggctgcagcccctggctacactgccagcg
agcgcggtgcacgacgaggaggcagcgatgtcagttcccagatgtaaatctctgaaggaa
acggacttaattaaaacttctgtgtcagactgctattgctacaatcaacattcgcaaatc
cagtggacatatatgtggtcaactgtgcaggtgacagtaaccagcccgggcctgctcaat
attgtatatatcacaggaagtcataactgccagcacacagaaagcattttatcatttatc
aaatgtgtgactcataacttttgggcaccagaggaggctgaggagataaccatagtcttc
agtccatatggagaaactgtgtgcttctctgtgaagcctgttgggaggctccttccctac
atagtaagcgtgagtcgaaacattgtggatttcaaactcttccttgtgtttgtgacaggc
attttccttttcttgtatgcaaagaccttgagccaaagccctgttttctattactcttcc
ggtaccgtgttaggtattctaatgacattagtctttgtccttctgatggctaagaaacac
attccaaagtatagcacatttggggcgctaatgattggttgttggtttgcttcagtttat
gttttgtgccagttgatggaagatctgaagtggctgtggtatggaaacagaatgtatata
ttaggctatgtggtggttgttggactttgtagctttgctgcctgttacagtcacgggcct
cttgctgatgaggggagcagagaccttctcatgtggaccctgaggctcttctccctggct
ctggtctacactggtgtggccgctcctcagtttgcctatgctgttctgatcgtcctcttg
ttctcctggagtctgcactatctcctgagagcattcagctatctcaggtggaaaatgagg
ccgtggttcacagcagaacctcaggtggcgaggtatctcactgatgacgagtacagggag
caagctgaagctgcaacagccagggctctcgaggaactgcgccaagcctgctgcaggcct
gacttcccttcctggctggctgtctccagactccaggctcctaaaaagtttgcagagttt
gttcttggagccagccacctgtcaccagaggaagtcagcacacatgaaaagcagtatggc
cttgggggtgccttcctggaggaacagctctttagcctgcagactgacagtctacctgca
agttga

DBGET integrated database retrieval system