KEGG   Mus musculus (mouse): 22724
Entry
22724             CDS       T01002                                 

Gene name
Zbtb7b, Thpok, Zfp67, c-Krox
Definition
(RefSeq) zinc finger and BTB domain containing 7B
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22724 (Zbtb7b)
   04121 Ubiquitin system [BR:mmu04121]
    22724 (Zbtb7b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    22724 (Zbtb7b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     22724 (Zbtb7b)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz GAGA zf-met DUF3268 Zn-ribbon_8
Other DBs
NCBI-GeneID: 22724
NCBI-ProteinID: NP_033591
MGI: 102755
Ensembl: ENSMUSG00000028042
Vega: OTTMUSG00000021268
UniProt: Q64321 Q5BJ24
Position
3 F1; 3 39.09 cM
AA seq 544 aa
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGTVMGTGGGGTASGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATTTASTSGMPN
GEDSPPQVPLLPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEAPTVLTHPLTYEEE
EMVGRLGNSGGSGLGDSYSPPTGAASPAEGPLNYEVFEGEEEEEEMAYPPGYGLAQSNEP
SLSPEELGSDEDPIDPDLMAYLSSLHQDALTPGLDGQDKLVRKRRSQMPQECPVCHKIIH
GAGKLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYD
LKNHMHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDVAAPHYPPPS
TTTSSPAGLDLSNGHLDTFHLSLARFWEQSATTGPPVTTQGPPEEEEEEGTPTTPQAEGA
MESS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggggagccccgaggatgacctgattggaatcccattcccagaccacagcagcgagctc
ctgagctgcctgaacgagcagcgccagctgggccatctgtgcgacctcaccatcaggacg
cagggtcttgagtaccgcacccacagggctgtgctggctgcctgtagccactacttcaag
aagctctttacggagggaggagggggaaccgtgatgggaacagggggtggtgggacggct
tctgggggagcaggggccggtgtgtgtgagctggactttgtagggccagaggccctaggt
gccctgctcgagtttgcttacacagccacactgaccaccagcagcgccaatatgccggct
gtactccaagctgctcggctactggaaatcccgtgtgtcatcgctgcttgcatggagatt
ctacaaggcagtgggctggaagcccccagccccgatgaggatgactgtgagcgagcccga
cagtacctggaggcttttgccactgccaccaccacagcctcaacctcaggaatgcccaac
ggtgaagacagccctccacaggtgcccctcctaccgccgccgccaccgccacctcgacct
gttgcccgtcgcagccgcaaaccccggaaagcttttcttcaaaccaaaggggcccgagca
aaccatctggtccctgaggcacccacagtactcacccatcccttgacctacgaagaagaa
gagatggttggtagattgggtaacagtgggggcagtgggctcggagatagctatagtcct
cctacaggtgccgcctcacctgccgaggggcccctgaactatgaagtctttgaaggtgag
gaagaagaggaggagatggcataccccccaggctacgggctagcccagagtaatgagccc
tcgctatcaccagaggagctgggctcagatgaagatcccatcgaccccgacctgatggct
tacctaagttcgctgcaccaggacgccctgacaccaggcctggatggccaagacaagctg
gtgcgtaaacgccgttcacagatgccccaagagtgcccagtctgtcacaagataatccac
ggggcaggcaaactgcctcggcacatgaggacccacactggtgagaagccctttgcctgt
gaggtctgcggcgtccgcttcaccaggaatgacaagctgaagatccacatgcggaagcac
acaggagaacgcccctactcgtgcccccactgcccagcccgcttcctgcatagctacgac
ctcaagaaccacatgcacctgcacaccggggaccggccctatgagtgccacctgtgccac
aaggccttcgccaaggaggaccacctgcagcgccatctcaagggtcagaactgcctggag
gtgcgcacccgaaggcgccgcaaggatgacgtggcagcccctcactacccaccgccctcg
accaccacctcatcccctgctggcctcgacctttccaatggccacctggacaccttccac
ctctctctggctcgattctgggagcagtcggccaccacgggacccccagtcactacacaa
gggccccctgaggaggaggaagaggaagggacacccaccacaccacaggccgaaggtgcc
atggagtcctcttaa

DBGET integrated database retrieval system