KEGG   Mus musculus (mouse): 227298
Entry
227298            CDS       T01002                                 

Symbol
Retreg2, Fam134a
Name
(RefSeq) reticulophagy regulator family member 2
  KO
K23880  reticulophagy regulator
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    227298 (Retreg2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    227298 (Retreg2)
SSDB
Motif
Pfam: MASE2 Reticulon
Other DBs
NCBI-GeneID: 227298
NCBI-ProteinID: NP_739561
MGI: 2388278
Ensembl: ENSMUSG00000049339
Vega: OTTMUSG00000048449
UniProt: Q6NS82
Position
1; 1 C4
AA seq 541 aa
MASSGGGNTGAGGTSGLGLGLGLSLGMGEATGDAEEEAAAAEAVGRLATSLWLRLRGWEA
VLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSISLLTYFLLDLWHPRFL
PDVSAPPPEEPHSDSEGAGSGAQPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQ
FCARGCAACAVLAVLGHYVPGVMISYIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDY
SMKAEADALHHKHDKRKRQGKSAPPAGDEPLAETESESEAELAGFSPVVDVKKTALALAI
TDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEEALNRELGEGEETEL
ASPEDLLSAPPALSKQALDTEEEGAADKEALLQLSSPLHFVNTHFNGAGSPQDGVKCPPG
APVKTLSPEAVSGDLMAPSSTLSPQLCLAESGPVTPLSPSVLPSLPQDSPQPLAAPEEEE
ALTTEDFELLDQGELEQLNAELGLGPEMPPKPPDVLPPPPLGADSHSLVQSDQEAHAEVE
P
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcgagcagcggtggcggtaacaccggcgcgggtggcacctcggggctgggcctgggc
ctggggctgagcctcggcatgggtgaggccactggcgacgcggaggaggaggcggccgca
gccgaggcagtgggacgtttagctacgtccctgtggctgcggctccgcggctgggaggcg
gtgctggcggccgcacagcgactgctggtttgggagaagccgctgcacagcctggtcacg
gcggccacactcaacggcctcttctggttgttgtcttcgtcgtccctccggcccttcttc
ctgctcagcatctcacttttgacctattttctactggatctctggcatcctcgctttctc
cctgacgtttcagcaccaccccctgaagaaccacactctgacagtgagggtgcggggtca
ggcgcccagccgcacctgctgagtgtgcccgagttgtgcagatacctggctgagagctgg
ctcaccttccagattcacctgcaagagctgttgcagtacaagaggcagaatccagctcag
ttctgcgctcggggctgcgctgcctgtgctgtgctggctgtgttgggacactatgttccg
ggagttatgatttcctacattgtcttgctgagtatcctgctgtggcccctggtggtctat
cacgagttgatccagaggatgtatactcgcctggagcccttgctcatgcagctggactac
agcatgaaagctgaagctgatgccctgcaccacaaacatgacaagagaaagcgccaaggg
aagagtgcacccccagcaggagatgagccactggcggaaacagagagtgaaagcgaggca
gagttggctggcttctctccagtggtggatgtgaagaaaacagccctggccttggctatt
acagactctgagctgtcagatgaggaggcctctatcttagagagcggcggtttctctgta
tctcgggccaccactccacaactgacagatgtttctgaagatttggaccagcagagcctg
ccaagtgagccagaagaggctctgaaccgagagctgggggagggggaagagacagagctg
gcctctcctgaagacctgctaagtgcgcctccagccctctcaaagcaagctttggacacc
gaagaggagggggctgcagacaaggaagccttgcttcagctctcatcccctcttcacttt
gtgaatacgcacttcaatggggcagggtccccccaagatggagtgaaatgccctcctggt
gcaccagtgaagaccctgagcccagaggcagtgagtggtgacctaatggctccatccagc
accctctcaccccaactttgccttgctgaaagtggtccagttacccccctctctccctct
gtgctcccatcccttccccaggactcacctcaacccctggctgctcctgaggaggaagag
gcactcacaactgaggactttgagttgctggatcagggggagctggagcaactgaatgca
gagctgggcttgggaccagagatgcctccaaagccccctgatgttctgcctcctcctccc
ctgggggcagacagccattccctggtacagtcagaccaagaggctcatgcagaggttgag
ccatga

DBGET integrated database retrieval system