KEGG   Mus musculus (mouse): 227333Help
Entry
227333            CDS       T01002                                 

Gene name
Dgkd, AI841987, D330025K09, DGKdelta, dgkd-2
Definition
(RefSeq) diacylglycerol kinase, delta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    227333 (Dgkd)
   00564 Glycerophospholipid metabolism
    227333 (Dgkd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    227333 (Dgkd)
   04072 Phospholipase D signaling pathway
    227333 (Dgkd)
 09160 Human Diseases
  09161 Cancers: Overview
   05231 Choline metabolism in cancer
    227333 (Dgkd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     227333 (Dgkd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 SAM_1 PH PH_3 PH_8 C1_2 Mcp5_PH Rsc14 PH_11
Motif
Other DBs
NCBI-GeneID: 227333
NCBI-ProteinID: NP_808314
MGI: 2138334
Ensembl: ENSMUSG00000070738
Vega: OTTMUSG00000048195
UniProt: E9PUQ8
Position
1; 1 D
AA seq 1220 aa AA seqDB search
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTILKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKWTTLASIGKDIIEDEDGIAMPHQWLE
GNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLVMKCPLGLCKVSVIPPTA
LNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILAKLERASTKMLDRWSVMAYETKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSQESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLSNPPPTIAEEAEDGDGSGNICSSTGDHLVGSACPSRP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQQGFVLGLSESEKKDLKTDN
RVCTSSVHSESCVIAKGRSQRKASRAPCEKLVSKGLSLGSSASLPPGTGSRDSLPALNTK
ILYPSVRAGMSGSLPGGSVISRLLINADPFNAEPENLEYYTEKCVMNNYFGIGLDAKISL
DFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYRNLEQKVLLECDGRPIPLPSLQGI
AVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQ
CRTVKISILGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTLTRDRAFENTLKSWEDKQKC
ELSRPPSFSLHPEILSEEEATQMDQFGQAAGGLIHSIREIAQSHRAMEQELAHAVNASSK
AMERVYGKPRTAEGLNCSFVLEMVNNIRALRSETELLLAGKMALQLDPPQKERLGAALIE
MDQQLRKLTDTPWLCQPLEPGEEESLQQNVMLDLTKRSRSGKFRLVTKFKKEKNNKNKEV
HSNLGGPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGH
MKRILCGIKELSRSSPAAEA
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcgcccctccgccgggtcctcctcagccacctccgccgccgccg
cctgaggagtcgtccgacagtgaacccgaggctgagccgggctccccgcagaagcttatc
cgtaaggtgtccacgtcgggccagatccggcagaagaccatcctcaaagaaggcatgctg
accaaacagaacaactcgttccagcgatccaagaggaggtactttaagcttcgagggcga
acactttactatgctaaaactgcaaagtcgattatatttgatgaggtagacctgactgat
gccagcgtagcagaatccagcaccaaaaatgtcaacaacagttttacggtcatcactcca
tgtaggaagctcatcttgtgtgccgacaacaggaaagaaatggaagattggattgcagca
ctcaagactgtccagaacaaagagcattttgagcctacccaatatagcatggaccatttc
tcagggatgcacaactggtatgcttgttcccatgcacggccaacctattgcaatgtgtgt
cgtgaagttttgtcaggggtcacatcccatgggctatcctgtgaagtgtgtaagtttaag
gctcacaaacgttgtgctgtgcgtgcaactagtaactgcaagtggaccacattggcctca
atcgggaaggatatcattgaggacgaggatgggattgccatgcctcaccagtggttggaa
ggaaacctgcctgtgagtgccaagtgtatcgtgtgtgacaagacttgtggcagcgtgtta
cgcctgcaggactggcgctgcctctggtgcaaagccatggttcacacatcttgcaaagag
tccttggtgatgaagtgtccacttggcctgtgcaaggtgtctgtcatccctcccacggca
ctcaacagtattgactccgatgggttctggaaggccacctgtcccccgtcttgtacaagc
cctctgctggtttttgtcaactcaaaaagtggagacaatcaaggtgtgaagtttctcaga
agattcaagcagctgctgaaccctgcccaggtttttgacctcatgaatggaggaccacac
cttggcttacggttatttcagaagtttgacaccttccggattctggtttgtggcggggat
ggcagtgttggctgggtcctctctgaaatcgatagcctcaaccttcacaaacagtgtcag
ctaggtgtgctgcccctggggacagggaacgacctggcccgtgttcttggctggggctct
gcctgtgatgatgatacacagcttcctcagatcttggcaaagctggagagggccagcact
aagatgctggacaggtggagtgtcatggcatatgagaccaagctccctcggcaggcctcc
tcctccactgtcactgaggacttcagcgaggactcagaggtgcagcaaattctcttctat
gaagactcagtcgcagctcatctttctaaaatcttaacttcggaccagcattctgtggtg
atctcatcagccaaagtgctctgtgagacagtgaaggactttgtggctcgagtgggcaag
gcctatgagaagacgacagagagctcgcaggagtcagaggtcatggccaagaagtgctct
gtcttgaaagagaaactggactctctcctcaagaccttggatgacgagtctcaggcttca
tcctctctgtctaacccacctcctaccattgctgaggaggctgaggatggggacggatca
ggcaacatctgtagctctactggggaccatttggtgggctcggcatgcccctcccggcca
cagatcttccggccccgggagcagctaatgctgagagccaacagcctgaagaaagcaatt
cgccagattatagagcacacagaaaaagcggtggatgagcagaatgcccagacccaggag
cagcagggttttgtcctaggcctctctgaatctgagaagaaggacttgaagactgacaac
agggtgtgcacatcatctgtccatagtgagagctgtgtgattgccaaggggagaagtcaa
cgcaaagcatccagggccccttgtgagaagctggtgagcaaaggcctgtcactcggcagc
tctgcctcactccctcctggtacaggaagccgggacagcctgcctgctctgaacaccaag
atcctatatccaagtgttcgggcagggatgtctggctccttgccagggggctcagtcatc
agtcgcttgttaattaatgctgatccctttaatgctgaacctgaaaacctagaatactac
acagagaagtgtgtcatgaacaactattttggcattggcttggatgcaaagatatctctg
gacttcaacaacaagcgtgatgagcacccagagaaatgcaggagtaggactaagaacatg
atgtggtatggtgtccttggcaccaaagagctgctgcacagaacctacaggaacctggaa
caaaaggtcctgctggagtgtgatggccgccctattcccctcccgagtcttcaaggaatt
gctgtcctcaacattcccagctatgctggagggaccaacttctgggggggcaccaaggaa
gatgatacttttgcagctccatcattcgatgataagattctggaggtggttgctgtgttc
ggcagcatgcagatggctgtgtctcgtgtaattaagctacagcatcatcggattgcccag
tgtcgcacagtgaagatctccatcctgggggatgaaggcgtgcctgtgcaggtggatggg
gaagcctggatccagccacctgggtacattcggatcgtgcacaagaacagggcgcagaca
ttgaccagagacagggcctttgaaaacaccctgaagtcttgggaagacaaacagaagtgt
gagctgtcccgcccaccctccttttccctgcaccctgagatcctgtctgaggaggaagct
acccagatggatcagtttgggcaggcagcagggggcctcattcacagcattcgggagata
gcacagtcccacagagccatggaacaggagctcgcacatgctgtcaatgccagctccaaa
gccatggagcgagtatacggcaagcccagaactgcagaggggttgaactgtagctttgtt
ctggagatggtgaataacatcagagcactgcgcagtgagacagagctgctgctggctggg
aagatggccctgcaattggatccccctcagaaggaacggctcggggctgccctaattgag
atggaccagcagctcaggaagctgacagacactccctggctttgccagcccttggagcct
ggtgaggaagagtctctccaacagaatgtgatgctggatcttactaaacgcagccgtagt
ggtaaattccgccttgtgaccaagtttaaaaaggagaaaaacaataagaacaaagaagtt
cacagtaacctaggaggccctgttcacctctgggggacagaggaggttgctgcctggctg
gagcacctcagtctctgtgagtataaggacatcttcacgcggcacgacatccggggctct
gagctcctgcacctggagcggagggacctcaaggaccttggtgtgaccaaagtgggccat
atgaagaggatcctttgtgggatcaaggagctgagccggagctcccctgccgccgaggcc
tag

DBGET integrated database retrieval system