KEGG   Mus musculus (house mouse): 227358
Entry
227358            CDS       T01002                                 
Symbol
Erfe, 4832406C22, Fam132b, myonectin
Name
(RefSeq) erythroferrone
  KO
K24381  erythroferrone
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    227358 (Erfe)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 C1q domain-containing proteins
  CBLN / gliacolin group proteins
   227358 (Erfe)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 227358
NCBI-ProteinID: NP_775571
MGI: 3606476
Ensembl: ENSMUSG00000047443
UniProt: Q6PGN1
Position
1:91293033..91301939
AA seq 340 aa
MASTRRPVGARTLLACASLLAAMGLGVPESAEPVGTHARPQPPGAELPAPPANSPPEPTI
AHAHSVDPRDAWMLFVKQSDKGINSKRRSKARRLKLGLPGPPGPPGPQGPPGPFIPSEVL
LKEFQLLLKGAVRQRESHLEHCTRDLTTPASGSPSRVPAAQELDSQDPGALLALLAATLA
QGPRAPRVEAAFHCRLRRDVQVDRRALHELGIYYLPEVEGAFHRGPGLNLTSGQYTAPVA
GFYALAATLHVALTEQPRKGPTRPRDRLRLLICIQSLCQHNASLETVMGLENSSELFTIS
VNGVLYLQAGHYTSVFLDNASGSSLTVRSGSHFSAILLGL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcctcgacccgccgccccgtcggagctcgcacgctgctcgcctgcgccagcctactc
gccgccatgggcctcggtgtccctgagtccgcggagcccgtggggactcatgcacgcccg
cagccgcccggggccgagctgcccgccccgccagccaacagcccgccggaacccaccatt
gcgcatgcacacagtgtggatccccgggatgcttggatgctgttcgtcaagcagagtgac
aaggggatcaacagtaagaggaggagcaaagccaggaggctgaagcttggcctgccagga
cccccagggccaccaggtcctcagggccccccaggcccctttatcccatctgaggttctg
ctgaaggagttccagctgttgctgaaaggcgcagtacggcagcgagagagccatctggag
cactgcaccagggatctcactacaccagcctcgggtagcccttcccgtgtcccagccgcc
caggagcttgatagccaggacccaggggcattgttagctctgctggctgcgaccttggcc
cagggcccgcgggcaccacgtgtggaggccgcattccactgtcgcttgcgccgggatgtg
caggtggatcggcgtgcgttgcacgagcttgggatctactacctgcccgaagttgaggga
gccttccaccggggcccaggcttgaatctgaccagcggccagtacaccgcacctgtggct
ggcttctatgcgcttgctgccactctgcacgtggcactcaccgagcagccaagaaaggga
ccaacacgaccccgggatcgtctgcgcctgctgatctgcatccagtctctctgccagcac
aatgcctccctggagactgtgatggggctggagaacagcagcgagctcttcaccatctca
gtaaatggtgtcctctatctacaggcaggacactacacttctgtcttcttggacaatgcc
agcggctcctccctcacggtacgcagtggctctcacttcagtgctatcctcctgggcctg
tga

DBGET integrated database retrieval system