KEGG   Mus musculus (house mouse): 227399
Entry
227399            CDS       T01002                                 
Symbol
Ppip5k2, Cfap160, D330021B20, Hisppd1, Vip2, mKIAA0433
Name
(RefSeq) diphosphoinositol pentakisphosphate kinase 2
  KO
K13024  inositol-hexakisphosphate/diphosphoinositol-pentakisphosphate 1-kinase [EC:2.7.4.24]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    227399 (Ppip5k2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.24  diphosphoinositol-pentakisphosphate 1-kinase
     227399 (Ppip5k2)
SSDB
Motif
Pfam: His_Phos_2 PPIP5K2_N RimK Elf4 Cnd1_N
Other DBs
NCBI-GeneID: 227399
NCBI-ProteinID: NP_776121
MGI: 2142810
Ensembl: ENSMUSG00000040648
Position
1:complement(97633768..97698133)
AA seq 1129 aa
MSNSRKMSEPPRFFVGPEDAEINPGNYRRFFHHAEEEEEEEDESPPERQIVVGICSMAKK
SKSKPMKEILERISLFKYITVVVFEEEIILNEPVENWPLCDCLISFHSKGFPLDKAVAYA
KLRNPFVINDLNMQYLIQDRRDVYSILQAEGILLPRYAILNRDPNNPKECNLIEGEDHVE
VNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSY
IYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREKLIA
WKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIVMRELAPQF
HIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKC
DGYKSGKLKLKKPKQLQEVLDIARQLLMELGQNNDSEIEENKSKLEQLKTVLEMYGHFSG
INRKVQLTYLPHGCPKTSSEEEDNRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMY
PGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQ
MVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISVIKSMH
LIKNPVKTCDKVYSLIQSLTSQIRYRMEDPKSADIQLYHSETLELMLRRWSKLEKDFKTK
NGRYDISKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGITKAEKLEI
AKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVYSRGVLSPERHVRTRLYFTSESHVHSLLS
ILRYGALCDDSKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFS
PGAKGCEEDKNLPSGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEP
IHIHRKSPLPRSRKITANEVVSENANYLRTPRNLVEQKQNPTVGFELYSMVPSICPLETL
HNALFLKQVDDFLASIASPSTEVLRKVPEMSSMATRSSPGMRRKISLNTYTPTKILPTPP
AALKSSKASSKAAAGGPSQAMAPHTSSRKKSINSKTEGHEPKKSTGKKR
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgtcaaattcaagaaaaatgagtgaaccccccagattctttgttgggcccgaagatgcg
gaaatcaatcctggaaactatcgtcgcttcttccaccatgctgaagaggaggaggaggag
gaggatgagtctccaccagaaaggcagattgtggttggaatatgttccatggcaaagaaa
tccaaatccaaacccatgaaggaaattctggaacggatctccttgtttaagtacatcaca
gtagtggtttttgaagaggaaattattttgaatgaacccgtggaaaactggcctttatgt
gattgtcttatttctttccattctaaaggatttccactggacaaagcagttgcctatgca
aaactcaggaatccatttgtaatcaatgacttgaatatgcagtatctcatacaagataga
agagacgtgtatagcattcttcaagctgaaggcatcctacttcctcggtatgcaatcctg
aaccgtgatccaaataacccgaaagaatgcaacctgattgaaggagaagatcatgtagaa
gtgaatggggaagttttccaaaagccctttgtggagaagccggtcagtgcagaggaccac
aatgtttacatttattatccaacatccgccggaggtgggagtcagagacttttccggaag
attggcagtagaagtagtgtgtattccccagagagcaacgttcgaaaaacggggtcatat
atatatgaagagtttatgcctacagatggtactgatgttaaggtttataccgtgggtcca
gactatgcacatgctgaagctcgaaaatctccagctctcgatggcaaggtagagcgagac
agcgaagggaaggaagtaagataccccgtcatcctcaatgcacgggagaagctgattgcg
tggaaagtctgccttgcttttaagcaaacggtttgtggctttgatttgttacgtgccaat
ggacaatcctatgtatgcgatgtcaatggcttcagttttgtgaaaaattccatgaagtac
tatgatgactgtgcaaaaattcttggcaatatcgtaatgcgggagcttgcaccacagttt
catatcccgtggtcaataccattagaagctgaagatattccaattgtaccaactacctct
ggaactatgatggaacttcgatgtgtcatcgctgtgatacgacatggggatcgaacaccg
aaacagaaaatgaaaatggaagtgaggcatcagaagttttttgacctttttgaaaagtgt
gatggatataaatcagggaagttaaagctcaagaagccaaaacaattacaggaagtcctg
gatattgcaaggcagcttcttatggagctggggcaaaataatgactctgaaattgaagaa
aacaagtcaaaacttgaacaacttaagactgtgttagagatgtatggtcatttttcagga
ataaaccgtaaggtccaattaacctatcttcctcatggctgtccgaaaacatccagtgag
gaggaagataaccgaagagaggagccgtccttacttttggttctaaaatggggaggagaa
ctgacccctgcgggcagggttcaggctgaagagctgggaagagcttttcggtgtatgtac
cctggaggtcaaggagattatgcaggatttcctggttgtggtttactccgactacatagc
acctacaggcatgacctcaaaatatatgcctctgatgaagggcgggtccagatgacggcg
gctgctttcgcaaagggtctcttggctctagaaggagagcttacccccattcttgttcag
atggtgaaaagtgcaaacatgaacggccttttggatagtgatagtgactctttgagtagc
tgtcagcagcgtgtgaaagcgaggcttcatgaaatacttcagaaagacagggatttcaca
gctgaggactacgagaagcttactccatctggaagcatttctgttatcaaatcaatgcat
ttgattaaaaatccagtgaaaacctgtgacaaagtgtattccttgattcaaagtttgact
tcccaaattagatatcggatggaagatcccaaatcagctgatattcagctttaccacagt
gagaccctggaacttatgctgcgtagatggtccaagttggagaaggattttaaaacaaag
aatggaagatatgatattagcaagatccctgacatatatgactgcatcaaatatgacgtt
cagcataacggttccttgaagttagaaaacacaatggaactatataggctttcaaaggca
ttagcagatattgttatccctcaggaatatggtataactaaagctgaaaaactggagatt
gccaaaggctactgtactccactagttagaaaaatccgatcagatcttcagaggacacaa
gatgatgatactgtcaataaactccatcctgtgtattctagaggtgttctgtctcctgag
cggcacgtccgcaccagattatattttaccagtgagagtcatgtgcattctttactatcc
attcttcggtatggcgccttatgcgatgactcaaaggatgagcagtggaaacgagctatg
gattatctaaacgtcgtcaatgagctcaactacatgacgcagattgttatcatgctctat
gaggatcccaacaaggacctttcctcagaggaacgctttcatgttgagttacattttagt
cctggagccaaaggctgtgaagaagataagaatttgccatctggctatgggtataggcca
gcatccagggagaatgaaggcagaaggtctcttaaaactgacgatgatgagcctcacact
tctaaacgagatgaagttgaccgggccgtgatgttgtttaaaccattggtgtctgagcca
attcatatacacaggaaatcaccgcttccgaggtccaggaagattactgcaaatgaggtt
gtgtctgagaatgccaactatctccgaacaccaagaaatcttgtggaacagaagcagaac
cctacagtaggcttcgagctgtattccatggtaccatccatctgtcctctagaaacactt
cacaatgccctgtttttaaagcaagtggatgactttctggcttccattgcttctccatca
acggaggttctgcgcaaggtccccgaaatgtcctctatggccacacgttccagtccagga
atgagaagaaaaatttccttaaatacgtatacacctacaaagatcctcccaacaccacct
gctgctttaaagagcagcaaagcaagcagcaaagcagcagccggcggaccatctcaggca
atggctccccatacctcatctcggaagaagagcataaatagcaaaaccgaggggcatgaa
cccaagaaaagcactgggaagaaaagatga

DBGET integrated database retrieval system