KEGG   Mus musculus (mouse): 227449Help
Entry
227449            CDS       T01002                                 

Gene name
Zcchc2, 9930114B20Rik, AW212015
Definition
(RefSeq) zinc finger, CCHC domain containing 2
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    227449 (Zcchc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC zf-CCHC_4 zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 227449
NCBI-ProteinID: NP_001116148
MGI: 2444114
Ensembl: ENSMUSG00000038866
Vega: OTTMUSG00000026946
UniProt: Q69ZB8
Position
1; 1 E2.1
AA seq 1166 aa AA seqDB search
MLRMKLPPKSTHPSEPPPDAEEPEADARPGAKAPLRRRRDCRPPPPPTGLPRGPPPPPSP
PRGLEPPVASGPTAGAGMPGGGGHAAALREQERVYEWFGLVLGSAQRLEFMCGLLDLCNP
LELRFLGSCLEDLARKDYHYLRDSEAKANGLSDPGSLADFREPAVRSRLIVYLALLGSEN
REAAGRLHRLLPQVDAVLRSLRATRAEGSRGSVEDEPSGDGEQDAEKDGPGPEGSGCAKL
GTGGGLGFRAQEELLLLFTMASLHPAFSFHQRVTLREHLERLRSALRVEPEDAEVEPSNF
AGSRAQNDSACGDYIQSNETGLVEQAQIPPDGLTVAPHRAQREAVHIEKIMLKGVQRKRA
DKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKEFSSESFDKTILKALNQGSLRREE
RRHPDLEPILRQLFSTSPQAFLQSHKVRSFFRSISSESQHNFNNLQSSLKTSKILEHLKE
DSSEASSQEEDVLQHTIIHKKHAGKSPALNVATSCSPLDGLTMQYAEQNGIVDWRNQGCA
AIQHSEHCVSSADQHSAEKRSLSSGNKKKGKPQVEKEKVKKTEDRLNSRINGIRLSAPQH
VHGSTVKDMNLDIGSGHDTCGETSSESYSSPSSPRHDGRESLESEEEKDRDSDSNSEDSV
NPSSARFSGYGSVAQTIAVKPPAETVSLGTEDGNLLEAALTSHKYPHIPFMPTLHCVTHN
GAQKSQVVIPSPKSADGKTLGMLVPNAVAISAVMESSNSAPVGILGPAASGESEKHLELL
ASPLPLPSTFLPHSSAPALQLTLQSLKLQPPQGSSDSCPVSIPPQPTGSLSIGSPNTAFI
PVHNPGSFPGSPVATTDPITKSAPQVVGLNQMVPQIEGNTGTVPQPSNVKVVLPAAGLSA
AQPPASFPFPGSPQAASALPTQNSSALNAATSAQPASTGISPSQSTVPPAVPTHTPGPAP
SPSPALTHSTAQSDSTSYISAVGNTNANGTIVPPQQMGPCGSCGRRCSCGTNGNLQLNSY
YYPNPMPGPMYRLPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGS
QASYGMQQMAGFGRLYPVYPAPNVVANTSGSGPKKNGNVSCYNCGVSGHYAQDCKQSSME
ANQQGTYRLRYAPPLPPSNDTLDSAD
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggatgaagctgccaccgaagtcgacgcaccccagcgagccgccgcccgacgcg
gaggagcccgaggcggacgcgcggccgggcgcaaaggctccgctgcgccgccgccgcgac
tgccgcccgccgccgccgcccacgggcctgccgcggggacccccgccgccgccgtcgccg
ccccgggggctcgagccgcctgttgctagcgggccgacggcgggcgcgggcatgccgggc
ggcggcgggcacgcggcggcgctgcgcgaacaggagcgggtgtatgagtggttcgggctg
gtgctgggctcggcgcagcgccttgagttcatgtgcgggctgctggacctgtgcaacccg
ctggagctgcgctttctcggctcgtgcctggaggacttggcgcgcaaggactaccactac
ctgcgcgactcggaggcgaaggccaacggcctctcggacccagggtcgctggccgatttc
cgagagcccgccgtgcgctcgcgcctcatcgtatacctagcgctgctgggctcggagaac
agagaggccgctggccgcctgcaccgcctcctgccccaggtggacgcggtgctcagaagc
ctgcgcgcgactcgagccgagggctcgcggggcagcgtggaggacgagccgagtggcgat
ggcgagcaggacgcggagaaggacggccccggcccggaaggcagtggctgcgccaagctc
gggactggaggcgggctcggcttcagggcccaagaggaactgctgctgctgttcaccatg
gcttcgctgcacccggctttctccttccaccagcgggtcaccctgagggagcacctggag
aggctccgcagcgcactccgggtggagccggaggacgcggaggtggagcccagcaacttt
gcgggctccagggcccagaacgactctgcctgtggtgactatatacagagtaatgagact
ggtttagtagagcaagcccagatacctccagacggactcactgtggcccctcatcgagct
cagcgagaagctgtccacattgagaagataatgttgaaaggagtccagagaaaaagggct
gacaagtactgggagtacactttcaaagtaaattggtctgacctttcagtcacaacagta
acaaaaacccaccaagaactacaggaatttctactgaagcttccaaaggaattctcttct
gagagttttgacaagaccatcttaaaagccctgaatcagggttctctaaggagggaagag
cggcgccaccctgacctggagcccatcctaaggcagctgttttcaacctcaccccaggct
ttccttcagagtcacaaagtccgcagcttttttcggtcgatctcatcggagtctcaacac
aatttcaataacttacagtcctctctgaagacttctaagatattagaacacttaaaagaa
gacagctcagaagcttcaagtcaagaagaagatgtgttacagcacaccatcatccacaag
aaacatgctgggaaaagtcccgctctgaatgttgctacaagctgttctccattggatggc
cttaccatgcagtatgcagaacaaaatggaattgtggattggaggaaccaaggctgtgcg
gccatccaacactcagaacactgtgtgtcctcagctgaccaacactctgctgaaaaacgg
agcttatcttcaggaaataagaagaaagggaagccacaagtagaaaaggagaaagtaaag
aaaactgaggacagattgaacagcagaataaatggaattagactctctgctccacagcat
gttcatggcagtactgtgaaagatatgaatttggacattggatctggacatgacacatgt
ggagaaacatcttcagagagttacagctctccgtctagtccacggcatgatggaagagag
agtttggaaagtgaagaagagaaggacagagattcagacagcaattctgaagattctgtg
aatccgtcgtcagccaggttttcaggttatggctctgtcgcccagaccatcgcagtcaag
ccgcctgctgagactgtctccctgggaaccgaggacgggaatcttttggaagctgcactg
acctcacacaagtacccgcatattcccttcatgccaactctacactgtgtcacgcacaac
ggtgcccagaagtcgcaagttgtcattccgtcgcccaaatctgcagatggcaaaacctta
gggatgcttgtccctaatgcggtggctatttctgcagtgatggaatcctcaaattcagcc
cctgttggaatcctaggcccggcagcttctggggagtcagagaaacaccttgagttgtta
gcttcccctttacctctcccatcaaccttcctcccacacagcagtgcgcctgctttgcag
ctgacattacagagtctaaagttacagccaccacagggatcttctgacagttgtccagtt
agtatcccaccacaaccaaccggaagtctgagcatcggatcaccaaacactgcctttatt
cctgtccataacccaggtagtttcccagggtctcctgtggctaccacggatcccatcaca
aaatccgcaccccaagtggtaggactaaatcaaatggtgcctcagattgaggggaacaca
gggacagtccctcagccgagcaatgtgaaggtagttcttccggcagcgggcctctcagct
gcacagccaccagcttccttcccctttccaggctcaccccaggctgccagtgcactcccc
acccagaattccagtgcgctcaacgcagccacttctgcccagccagcaagcacaggcatc
agtccatcccagtccacagttccccctgctgttcccacccacaccccaggccctgccccg
agccccagccctgccttgacacacagtactgcacagagcgacagcacgtcgtacatcagt
gctgtggggaacacgaatgctaacgggaccatagtgccaccacagcagatgggtccctgt
ggttcttgtgggcgaaggtgcagctgcgggaccaatggaaacctccagctaaatagttac
tattatcccaacccaatgcctggaccaatgtaccgactcccatcattcttcactctgcca
tccatttgcaatggcagctacctcaaccaagcacatcagagcaatggaaaccaacttcct
ttttttctgcctcagactccatatgcaaatggactggtgcatgacccagtcatggggagc
caagccagctatggcatgcagcagatggcaggatttgggagattgtatcctgtatatcca
gcacctaatgtagttgccaacaccagtggttctgggcccaagaagaatgggaatgtctca
tgttacaattgtggtgtaagcggacactatgcacaagactgtaagcagtcatccatggag
gccaatcagcaaggcacttacagactgagatacgcacctcccctccccccttctaatgat
acgttggattctgcagactga

DBGET integrated database retrieval system