KEGG   Mus musculus (house mouse): 227545
Entry
227545            CDS       T01002                                 
Symbol
Proser2, 5430407P10Rik, AU067770
Name
(RefSeq) proline and serine rich 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SARG
Other DBs
NCBI-GeneID: 227545
NCBI-ProteinID: NP_001153129
MGI: 2442238
Ensembl: ENSMUSG00000045319
UniProt: Q8C5R2
Position
2:complement(6103304..6135100)
AA seq 471 aa
MPGNQQKPESLETDSDTSPSCGLSDLSRGGSLESRCSSSRSRSFTMDDESLKHLTHEEKD
VILFFEETLDSLEYDFDEPALCDSGIHCHSPQSLEESPSSHSEPEDVIDLVQPAPASGEA
ESLPDMPQVTGAPSDTKHGTPFLEGGKQAAENSLPPPDSRGPEVFPLPPSLPVPAPSAPR
KELMSPSPPAEHPKLLRSVPTPLVIAQKISEKLAGNEALSPTSPSKEGRPGEWRTPTSPA
SRNGDHVGVWHRHTTQSAPKVHRFPSNISVTNSAGKDFNKTISKAAVNVQERKAQVLANI
NGMSFIAAGDTSSEERWQKAEEQRSGSADGARTLGRAGMAGEPGAPCAGVPARAQQSRAV
QTEQPPALANGFQSVHEALRSEPSSFVPTSKTITFRPDPAVTGKLARQNASRSLYEPRPD
GSQDARKRTGSLPRAVGFRPQGITVQFSGRGSTEEARREALRKLGLLKENL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgcctgggaaccagcagaaaccagagtctctggagacggactctgacacgtcgcccagc
tgcgggctcagcgacttgagcagaggtggcagtctggagagccggtgcagcagttcgcgg
tccagaagtttcactatggatgacgagagcctgaagcacctcacacatgaggaaaaggac
gttatcctgttctttgaagagactcttgattccctggaatatgactttgacgagccagcc
ctgtgtgacagtggcattcactgccactctccacagtctctggaagagagcccttccagc
cactctgagcccgaagatgtcatcgatttagtgcagcccgcacctgcgtctggggaagct
gagagccttccagatatgcctcaagtaacaggggccccatctgatacaaaacatggcact
ccatttcttgaaggtgggaaacaagccgctgagaattccctgccaccaccagactccagg
ggccctgaggtgtttcctttgccgccctccctgcctgtccccgctccctctgccccgcga
aaggagctgatgtccccctctcctccagcagagcatcccaaactgctgcgttctgtgccc
actcctctggtgattgctcagaaaatatctgagaagttggcgggcaatgaagccctgtct
cccacatccccttcaaaggaaggcaggcctggggaatggaggacaccgacttctccagct
tctagaaacggagaccatgtcggcgtgtggcatcgacacacgacccagtcagcacccaag
gtccatcgcttccccagcaacataagcgtgaccaacagcgcaggcaaggacttcaacaag
accatctccaaggcggctgtcaatgtgcaggagcgcaaggcccaggtcctggccaacatc
aacggcatgtccttcatcgctgcgggcgacacatcatcagaagagcggtggcagaaggcg
gaagagcagaggagtggctctgcggatggagcacgcaccctgggcagagcgggcatggcc
ggcgagcccggggcaccttgtgcaggagtcccggccagggcgcagcagtcccgggctgtg
cagacagagcagccaccggcgctggcgaacggcttccagagcgtacacgaggccctgcgc
agcgagcccagctccttcgtccccaccagcaagaccatcaccttccggcctgaccccgct
gtgaccggcaagctggcgcgccagaatgccagccgcagcctatacgaaccgcgcccggac
ggcagccaagatgcccgcaagcgcacgggctcgctcccccgggcggtgggtttccggccg
cagggcatcacagtgcagttctctggccgcggctccactgaggaagctcggcgcgaggct
ctgcgcaaactcgggctactgaaggagaacttgtga

DBGET integrated database retrieval system