KEGG   Mus musculus (house mouse): 22756
Entry
22756             CDS       T01002                                 
Symbol
Zfp94
Name
(RefSeq) zinc finger protein 94
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22756 (Zfp94)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22756 (Zfp94)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22756 (Zfp94)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-met C1_4 zf_UBZ zf-C2H2_6 zf-AN1 zf-trcl DUF4119 Zn_Tnp_IS1 zf-C2H2_11
Other DBs
NCBI-GeneID: 22756
NCBI-ProteinID: NP_001186250
MGI: 107610
Ensembl: ENSMUSG00000074282
UniProt: E9Q6Y4 Q3UUP5
Position
7:complement(24001129..24016091)
AA seq 486 aa
MTKVKEMVTFRDVAVVFSEEELGLLDAAQRKLYHDVMLENFRMLLSVGDKNPEEMESLEE
VGLRHLSHEALFCSQIWQQVSRDLMKAGDCRVSIRETGSPLKRDDAHGADRKYSKHSGQK
PWLQLHCGTDGGEEPYREERSEKDSWDSPLQANGRPPAGEKRYRCEKCDHAFCRLSGLQA
HQVRHTGEKPYKCEECGKGFTRASTLLDHQRGHTGNKPYQCHACWKSFCHSSEFNNHIRV
HTGEKPYVCEECGKGFSQASHLLAHQRGHTGEKPYKCSTCGKGFSRSSDLNVHCRIHTGE
KPYKCETCGKAFSRVSILQVHQRVHSEDKPYQCAECGRGFTVESHLQAHQRSHTGERPYQ
CEECGRGFCRASNFLAHRGVHTGEKPYRCDICGKRFRQRSYLHDHHRIHTGEKPYKCEEC
GKVFSWSSYLKAHQRVHTGEKPYRCEECGKGFSWSSSLLIHQRAHAEDEGRKDLPASEGS
QGKQTL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaccaaggtcaaggagatggtgaccttcagggacgtggccgtggtcttcagtgaggag
gagctggggctgctggacgctgctcagaggaagctgtaccacgatgtgatgctggagaac
ttcaggatgctgctctcagtgggagacaagaatcctgaggagatggagtctcttgaggaa
gtgggattgaggcacctgtcacatgaggcgcttttctgctcacaaatctggcagcaggtt
agcagggacctaatgaaggctggagactgcagagtaagcatcagggaaactggctctccg
ttgaagcgagatgatgcacatggtgcagacaggaagtacagcaaacattccggtcagaaa
ccatggctccaactccactgtggaacagatggtggtgaagaaccttacagagaggagagg
agcgagaaagactcttgggactctcctctgcaggctaacgggcgaccccccgcaggagag
aagaggtataggtgtgaaaaatgtgaccacgccttctgtcggttatcgggtctccaagcc
catcaggtgaggcacactggagagaagccatacaagtgtgaggagtgtggcaagggcttc
actcgggcctccacccttctggaccatcagcggggccacactggaaacaagccctatcag
tgccatgcttgctggaagagtttctgtcacagctcggagtttaacaatcacataagagtc
cacacgggagagaaaccctatgtatgcgaggagtgtgggaaaggcttcagccaggcctcc
catctcctggcccatcagagaggccacactggagagaaaccctacaaatgtagcacgtgt
gggaagggcttcagccggagttcagatctcaacgttcactgcagaatccacacgggagag
aaaccctataagtgtgagacgtgtgggaaagcctttagtcgggtctccatactccaggtg
caccagagggtccacagtgaagacaaaccgtaccagtgcgcagagtgtgggaggggcttc
actgtagagtcacaccttcaagcgcaccagcgctcccacacgggagagagaccctatcaa
tgtgaggagtgcgggcgaggcttctgtcgggcctccaactttctggctcatcgtggagtc
cacacaggcgagaaaccgtatcgatgtgacatatgcggaaaacgcttccggcagaggtcc
tacctccatgaccaccacaggatccacacgggagagaaaccttacaaatgtgaggagtgt
gggaaagtcttcagttggagctcatacctcaaggcccaccagagagttcacacaggagag
aaaccatacagatgtgaggagtgtgggaagggtttcagctggagctcaagtctcctaatt
caccagcgcgcccatgcagaggatgagggtcgcaaggatttgcctgcatcagaaggctca
caggggaaacaaactctataa

DBGET integrated database retrieval system