KEGG   Mus musculus (house mouse): 22759
Entry
22759             CDS       T01002                                 
Symbol
Zfp97, NGD16-4
Name
(RefSeq) zinc finger protein 97
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22759 (Zfp97)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22759 (Zfp97)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22759 (Zfp97)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 22759
NCBI-ProteinID: NP_035895
MGI: 105921
Ensembl: ENSMUSG00000095990
UniProt: E9PZP6
Position
17:17341372..17367400
AA seq 546 aa
MMRILSLPTENAVTYYDVLVSFTQEEWALLDPSQKSLYKDVMLETYRNLTAIGYNWEEDN
IEEDCENSGRPTRHLQRDGPSNTGEKPFECIQYDGAFARNHHQLHKDTGSFMSYTDRQIH
RRPHTEEKVYDGNQCGKTFSCHNHFEIRKGTYTGEKPYECNQCGKAFARNSNLLDHKRIH
TGEKPYKCKQCGKDFTHHSTLHIHKRIHTREKTYKCNQCMTIAHLQCHKITHTGEKLCEY
NQCWKAFAYHKTLQIHERTHTGEKLYQCNQCAKAFPYHRTLQIHERTHTGEKPYECNQCG
KAFACLRNLQNHKTTHTGEKPYECNQCGRAFRQYVYLQCHERIHTREKPFECNQCGKAFA
HHSTLQRHKRTHTGEKPYECNQCGKAFACPRYLQIHKRTHTGEKPYECNQCGKAFACYQS
FQIHKRTHTGEKPYECNQCGKAFACNRYLQIHKRTHTGERPYECNQCGKAFTCRSNLQIH
KRTHTGEKPYECNQCGKAFTQFFPLKRHEITHTKEKPYECNQCGKAFTRHSTLQIHKRTH
TGEKPV
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgatgaggatattgtcacttcccacagagaacgcagtgacgtactatgatgtcctggtg
agctttactcaggaagaatgggctttgctggatccttcccagaagagtctctacaaagat
gtgatgctcgaaacctataggaacctcactgccataggctataactgggaagaagataat
attgaagaagattgtgaaaattctggaagacccactaggcatcttcaaagggatggacca
agtaatactggagagaaaccctttgaatgtattcaatatgatggagcctttgcaagaaac
catcatcagttacataaggacactggatctttcatgtcttatactgatcgtcaaatacat
agaagaccacacactgaagaaaaagtctatgatggtaaccaatgtggtaaaaccttttca
tgtcacaaccattttgaaatccgtaaaggaacatatactggagaaaaaccctatgaatgt
aatcaatgtgggaaagcctttgcacgcaacagcaatcttctagaccataaaagaatacat
actggagagaaaccctataaatgtaagcaatgtggcaaagactttacccatcacagtact
cttcatatccataaaagaatacatactagagagaaaacctataaatgtaaccagtgtatg
accattgctcatcttcaatgtcataaaataacacatactggagagaaactctgtgaatat
aaccaatgttggaaagcctttgcatatcacaaaactcttcaaatccatgaaagaacacat
actggagaaaaactctatcaatgtaaccaatgtgccaaagcctttccatatcacagaact
cttcaaatccatgaaagaacacatactggagagaaaccatatgaatgtaatcaatgtggc
aaagcctttgcatgtcttagaaatcttcaaaatcataaaacaacacatactggagagaaa
ccctatgaatgtaaccagtgtggcagagcctttagacaatatgtttatcttcagtgtcat
gaaagaatacatactcgagagaaaccctttgaatgtaatcaatgtggcaaagcctttgca
catcacagcactcttcaaagacataaaagaacacatactggagagaaaccctatgaatgt
aatcaatgtggcaaagcctttgcatgtcccagataccttcaaatccataaaagaacacat
actggagagaaaccctatgaatgtaatcaatgtggcaaagcctttgcttgttaccaatct
tttcaaatccataaaagaacacatactggagagaaaccctatgaatgtaatcaatgtgga
aaagcctttgcatgtaacagataccttcaaatccataaaagaacacatactggagagaga
ccttatgaatgtaatcagtgtggcaaggcctttacatgtcgcagtaatcttcaaatccat
aaaagaacacatactggagagaaaccctatgaatgtaaccagtgtggcaaagcctttaca
caattttttcctcttaaacgtcatgaaataacacataccaaagagaaaccctatgaatgt
aaccagtgtggcaaagcctttacacgccacagtactcttcaaatccataaaagaacacat
actggagaaaaacccgtatga

DBGET integrated database retrieval system