KEGG   Mus musculus (mouse): 227612
Entry
227612            CDS       T01002                                 

Gene name
Tor4a, A830007P12Rik
Definition
(RefSeq) torsin family 4, member A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Torsin AAA_22 AAA_16 AAA AAA_5 AAA_18 AAA_24 AAA_33 Cytidylate_kin AAA_30 AAA_28 Viral_helicase1 ABC_tran PCRF
Other DBs
NCBI-GeneID: 227612
NCBI-ProteinID: NP_666227
MGI: 2442720
Ensembl: ENSMUSG00000059555
Vega: OTTMUSG00000011777
UniProt: Q8BH02
Position
2; 2 A3
AA seq 426 aa
MDRSHPSLEPQAKGPCVIAPVRAVLRLRRRVCVLRKRRLLQPGTEPDSGTGTLGPTGSLG
TLRADLDQPKFFTFDSLTELTSRTPRKRRRRSRVVLYPETSRKCRPRTERQSRAQRCLLL
LVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRSVFGQPAAVGRIMALLRDYLATHVHS
HPLLLALHGPSGVGKSHVGRLLARHFRAVLEDGALVLQYHARYHCPEPRPVQDCRKELAQ
RVADVVAQAEAEEKTPLLVLDEAELLPPALLDELHDLLQPQRSHHFHNAIYVLLSGAGGI
EITHFVLQNASRMLPPLRHSAGSTQTEESPAQELLTSLRELLAREHPLWHTAAIVPFLLL
DKPDVVNCFREEMAGEGFFPEQALAEHLAEQLSYYHVAGHEFAITGCKQVVAKVNLLQHK
PAHAGH
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggaccgcagccatcctagcctagagccccaggccaagggaccatgtgtgatagcgcca
gtgcgcgccgtgctccgtctgcgccgccgagtctgcgtcctgcgcaagaggcgcctcttg
cagccaggcactgagccggactctgggacagggacacttgggcccaccggcagcttgggc
actctacgtgccgacctagaccaacctaaattcttcaccttcgacagcctgacagagctg
acttctaggacaccccgcaagaggcgcaggcgtagtcgggtagttctctacccagaaacc
tcacggaagtgccgaccccgcacagagcggcagagtcgtgcacagcgttgtctgctgctt
cttgtagccattgtggggttccaggttctcaacgccattgagaatctagacgataatgca
caacgttacgacctcgacgggctggagaaggcgctgcagcgttctgtgtttggacagcca
gctgctgtgggccgcatcatggccctgctgcgagactacctggctacacatgtgcacagt
catcccttgctcctggcactgcacgggcccagtggtgtaggcaagagtcacgtggggcgt
ctgttggcgcgccactttcgcgcagtgctggaagatggtgctttggttctgcagtaccat
gcacgatatcactgtccagagccacgcccggttcaggactgccggaaggagctggcacag
cgagtggcagatgtggtggcacaggctgaggccgaggagaagacccctctcttggtcctg
gatgaggctgaactcttgccacctgcgctgctagatgagctccacgacctcctgcagcca
cagcgttcgcaccatttccacaatgctatctatgtactcctaagtggcgctggtggtata
gagatcacacactttgtgctgcaaaatgcgtcacggatgttgcccccactccgccatagc
gcaggcagtactcagactgaggaatctccagcccaggagttactcaccagtcttcgagag
ctcctggcccgagaacaccctctgtggcacactgcagccatcgtgcccttcctgctactg
gacaagccggatgtggtcaactgcttcagagaggagatggcaggggagggcttttttcct
gagcaggcactggcagaacatctggcagagcagctcagctactaccatgttgctggacat
gaatttgccatcaccggctgcaagcaggtagtagctaaggtcaacctcttacagcacaag
cctgcacatgctggacactag

DBGET integrated database retrieval system