KEGG   Mus musculus (mouse): 227632Help
Entry
227632            CDS       T01002                                 

Gene name
Kcnt1, C030030G16Rik, Slack, Slo2.2, slo2
Definition
(RefSeq) potassium channel, subfamily T, member 1
  KO
K04946  potassium channel subfamily T member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    227632 (Kcnt1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   227632 (Kcnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BK_channel_a Ion_trans_2 TrkA_C
Motif
Other DBs
NCBI-GeneID: 227632
NCBI-ProteinID: NP_001289280
MGI: 1924627
Ensembl: ENSMUSG00000058740
Vega: OTTMUSG00000012660
UniProt: Q6ZPR4 C0KTP6 Q8C853
Position
2; 2 A3
AA seq 1224 aa AA seqDB search
MARAKLPRSPSEGKAGPGDTPAGAAAPEEPHGLSPLLPARGGGSVGSDVGQRVQVEFYVN
ENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDNPDQGIGCWGCTKYNY
TFNGSSSEFHWAPILWVERKMALWVIQVIVATISFLETMLIIYLSYKGNIWEQIFHVSFV
LEMINTLPFIITVFWPPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMFNQVLI
LFCTLLCLVFTGTCGIQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPKIWPSQLLVVI
LICVTLVVLPLQFEELVYLWMERQKSGGNYSRHRARTEKHVVLCVSSLKIDLLMDFLNEF
YAHPRLQDYYVVILCPSEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEAC
FILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEEECK
YAMLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRTYGRCSGNEVYHIRMGDSKFFR
EYEGKSFTYAAFHAHKKYGVCLIGLKREENKSILLNPGPRHILAASDTCFYINITKEENS
AFIFKQEEKQKRRGLAGQALYEGPSRLPVHSIIASMGTVAMDLQNTDCRPSQGGSGGDGT
KLTLPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLSVVEYVKGY
PPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNG
LYNFIVPLRAYYRSRRELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCG
IIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQFR
AKDSYSLALSKLEKQERENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITR
LLLGLDTTPGSGYLCAMKVTEDDLWIRTYGRLFQKLCSSSAEIPIGIYRTECHVFSEPHD
VRAQSQISVNMEDCEDTREAKGPWGTRAASGSGSTHGRHGGSADPVEHPLLRRKSLQWAR
KLSRKSTKQAGKAPVATDWITQQRLSLYRRSERQELSELVKNRMKHLGLPTTGYEDVANL
TASDVMNRVNLGYLQDEMNDHHQNTLSYVLINPPPDTRLEPNDIVYLIRSDPLAHVASSS
QSRKSSCSNKLSSCNPETRDETQL
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggccaagctgccgcgctcgccgtccgagggcaaggcgggtccgggggacacc
ccagccggcgctgcagcccctgaggagccacacgggctcagcccgctactgccggcccgc
ggcgggggctccgtgggcagcgacgtgggccagagggtccaggtggagttctatgtcaat
gagaacaccttcaaagagcggctcaagctgttcttcatcaaaaaccaaagatccagcctg
aggatccggctgttcaacttctccctcaagctcctcacctgcctgctgtatatcgtccgt
gtcctgcttgacaacccagaccagggcatcggatgctggggctgcacgaagtataactac
actttcaatggctcatcctctgagttccactgggctcccatcctgtgggtggagaggaaa
atggctctgtgggtgatccaggtcattgtggccacaataagcttcttagagaccatgctc
atcatttacctcagctacaaaggcaacatctgggagcagatattccatgtgtctttcgtc
ttggagatgatcaacacactgcccttcatcatcacggtcttctggccacctctgcggaac
ctgttcatccccgtgtttctcaactgctggctggccaagcatgcgctggagaacatgatt
aatgacttccaccgtgccatcctacgcacacagtcagccatgttcaaccaggtgctcatc
ctgttctgcaccctgctgtgcctggtcttcacagggacctgtgggatccagcacctggag
cgagcaggtggcaacttgaacctgctgacctccttctacttctgcatcgtgactttctca
actgtgggcttcggtgatgtgacgcccaagatctggccatcccagctcctggtggtcatc
ctgatctgtgtcacccttgtggtgctcccactgcaatttgaagagcttgtctacctctgg
atggagcgtcagaagtcagggggcaactatagccgccaccgagcacggacggagaagcac
gtagtcctgtgtgtgagctccctcaagattgatctcctcatggacttcctgaatgagttc
tatgcccatccccggctccaggactactacgtggtcatcctgtgtccctctgaaatggac
gtccaggtgcgcagggtgctgcagattcccctgtggtcccagcgggtcatctacctccag
ggctctgccctcaaggaccaggatctcatgcgagccaagatggacaacggagaggcctgc
tttatcctcagcagcaggaatgaggtggaccgcacagctgcggatcaccagaccatcctt
cgagcctgggctgtgaaggactttgcccccaactgtcccctctatgtccagatcctcaag
cccgaaaacaagtttcacgtcaaatttgctgaccacgtggtatgcgaggaagagtgcaag
tacgccatgctggccctgaactgcatctgcccggccacctccaccctcatcaccctgctg
gtgcacacgtcccgtggccaggaaggacaggagtctcccgagcagtggcagcgcacgtac
gggaggtgctcgggcaacgaggtgtaccacattcgcatgggtgacagtaaattcttccgg
gagtatgagggcaagagcttcacctacgcagccttccacgcgcacaagaaatatggggtg
tgcctcatcgggctgaagcgtgaggagaacaagagtatcctgctgaacccaggaccacgg
cacatcctggctgcctccgacacctgcttctatatcaatattaccaaggaggagaactca
gctttcatcttcaaacaggaggagaagcagaagagacggggccttgcagggcaggcacta
tatgaagggccctcccggctcccagtgcatagcatcatcgcctctatggggacagtggcc
atggacctgcagaacacagattgccggccctcccagggtggcagtggcggggacggcaca
aagctgactctgcccaccgagaacggctctggtagtcgacgccccagcatcgcacccgtt
ctggagttggcagacagctcagccctgttgccctgcgacctgctgagtgaccagtcagag
gatgaggtgacaccctcggacgacgaggggctctctgtggttgagtacgtgaagggctat
ccccccaactcaccctacattggcagctccccgactttatgccacctcctgcctgtgaaa
gcccccttctgctgcctgcggttggacaagggctgcaaacacaacagctacgaggatgcc
aaggcctatgggttcaagaacaagctgattattgtctctgctgagacggcaggcaacggg
ctctacaacttcatcgtgcctctgcgcgcctactaccggtcccgccgggagctcaaccct
atcgtgttgctgcttgacaacaagcctgaccaccacttcctggaggccatctgttgcttc
cccatggtctactacatggagggatccgtggacaacctggacagcttactgcagtgtggc
atcatctatgctgacaacctggtggtggtggacaaggagagcactatgagcgctgaagag
gactacatggcagatgccaagaccatcgtcaatgtgcaaaccatgttccggcttttcccc
agtctcagcatcaccacggagctcacacacccttccaacatgcggttcatgcagttccgt
gccaaggacagctactctctggctctttccaaacttgaaaagcaagaacgggagaacggc
tccaacctggccttcatgttccgcctgccatttgctgctggtcgagtatttagtatcagc
atgttggatacactgctctaccagtccttcgtgaaggactacatgatcaccatcaccagg
ctgctcttgggccttgatactacaccaggctccggctacctctgtgcaatgaaggtaacc
gaggacgacctgtggatccgcacttacggccgcctcttccagaaactctgctcctccagc
gccgagatccccatcggcatctacaggaccgagtgccatgtcttctcggagccccatgac
gtcagagcccagtctcagatctcggtgaacatggaggactgcgaggatactcgggaggcc
aagggaccctggggcacacgagctgcatctggcagtggcagcacccatggccgtcacggg
ggcagtgctgacccagtggagcacccactactacgtcgcaagagcctgcagtgggcccgc
aagctgagtcgcaagagcaccaagcaggcagggaaggcacctgtggccacagactggatc
acccagcagcggctcagcctgtaccgacgctcagagcgccaggagctctcagagctggtc
aagaaccgaatgaagcacctgggactgcccaccactggctatgaggacgtagcaaattta
acagccagtgatgtgatgaatcgggtaaacctgggatatttgcaagatgagatgaacgat
catcaccagaacaccctttcctatgtactcatcaaccccccgccagacacaagactggaa
cccaacgacattgtgtacctcatccgttccgaccccctggcccatgtggccagcagctcc
cagagtcggaaaagcagctgcagcaacaagctctcatcctgtaatcctgagaccagggat
gagacccagctctga

DBGET integrated database retrieval system