KEGG   Mus musculus (house mouse): 227638
Entry
227638            CDS       T01002                                 
Symbol
Qsox2, BC030934, Qscn6l1, Soxn
Name
(RefSeq) quiescin Q6 sulfhydryl oxidase 2
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    227638 (Qsox2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     227638 (Qsox2)
SSDB
Motif
Pfam: FAD_SOX QSOX_Trx1 Evr1_Alr Thioredoxin OST3_OST6 eIF-5_eIF-2B Zn-ribbon_8
Other DBs
NCBI-GeneID: 227638
NCBI-ProteinID: NP_001289885
MGI: 2387194
Ensembl: ENSMUSG00000036327
UniProt: Q3TMX7
Position
2:complement(26099136..26127411)
AA seq 692 aa
MAAARAVARDPGAYARQPPSLRAARLPRLLFLLAVVAAVGPREGGGARLYREGSDAVWLL
DSGSVRSATGNSSAAWLVQFHSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEK
NQDVCRTYDIHFYPTFRYFKAFTKEFTTGENFKGPDRELRTVRQTMIDFLQNHTEGTWPP
ACPPLDPIQSSDILSFMDSHSGQYHAIVFESNGSYVGREVILDLIPYENIMVSRALDTDK
AFLGTLGITSVPSCYLIYPNGSHGLVNVAKPLRSFFSSHLKSLPDVRKKSLFLPEKSNKE
EKSEVVVWKEFDRAKLYTADLESGLHYLLRVELAAHRSLAGAQLKTFRDFVTVVAKLFPG
RPAVKKLLETLQEWLANLPLDKIPYNAILDLVNNKMQISGIFLTSHVKWVGCQGSRLELR
GYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFGCKECGEHFEEM
AKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGL
DSWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGEWEAQGREQEEGKGLNPSGKSWRHHDT
GSLRPPHILGPRTDLSKSLHHRLDLRLQSPQGPQALKEAKAVVPFLGVGFSSLDMSLCVV
LYVASSLFLMIMYFFFRVRSKRWKVRLYHPAV
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggctgccgcccgggctgtggcgcgggatccaggagcttatgcgcggcagccaccgtct
cttcgagccgcgcggctgccgcggctgctcttcctgctggcggtggtggcggcagtgggg
ccccgggagggcggcggggcgcggctctaccgcgagggctcagacgccgtgtggttgctg
gacagcggcagcgtgcggtcggccacgggcaacagctcagccgcgtggctggtgcagttc
cactcgtcgtggtgcggccactgcatcggctacgcacccacctggcgagcgctggcggcg
gacgtgcgagactgggctgctgccatccgtgttgctgctctggactgtgcagaagaaaag
aaccaggatgtgtgccgcacatatgacatccacttctaccccaccttcaggtattttaaa
gcatttacaaaggagtttacaacgggagaaaattttaaaggacctgacagggagctgcgg
acagtcaggcagacaatgatcgacttcctgcagaaccatactgagggcacctggcctcct
gcatgcccacccctggaccctattcagtccagtgacatcctttccttcatggatagccac
agtggccaataccatgctattgtgtttgaaagcaatggttcttatgttggacgagaggtg
atcttagatttgattccatatgaaaacatcatggtgagccgagcactggatacggacaaa
gcatttctggggacacttggcattacttcagtgccttcctgttacttgatttacccaaat
gggtctcatggactggttaatgttgcaaagcctctacgatcgtttttctcctctcattta
aaatccttaccagatgtaaggaaaaagtcacttttcttgcctgaaaagtccaacaaagaa
gaaaaatcagaggtggtggtttggaaagaatttgacagggccaagctgtatactgcagac
ctggagtcgggacttcactacctgctgagagtggagctggctgctcacaggtccctggct
ggagcccagttaaagacattcagggacttcgtgactgtcgttgccaagctgttccctggc
cggcctgcagtcaagaagctgttggagacactgcaggagtggttggccaacctccccctg
gacaagattccatataatgccatcctagacctagtcaacaacaaaatgcagatttctgga
atctttcttaccagccacgtaaagtgggtgggatgtcaaggaagtcgattggagttgagg
ggctacccatgctccctctggaaactgtttcacactttgacggttcaggcctccacccat
ccagaagcgctggctggcacaggctttgaaggccacccccaggctgtgttgcaggccatc
aggagatacattcgcacattctttgggtgcaaagaatgtggtgaacattttgaggaaatg
gctaaggagtccatggattctgtgaaaactccagaccaagctgttctctggctttggaga
aagcacaacatggtaaacagccgcctggcaggccatttgagtgaggaccccaagtttcca
aaggttccatggcccactccagacctctgcccagcctgccatgaggaaattaaaggcctg
gacagctggaatgagggccaggtgcttctgttcctgaaacagcactatagcagggacaac
ctggtggacgcatactctgtggaccagggcagtcctggtgagtgggaagcccagggcaga
gagcaagaagaaggcaaaggtcttaacccctcagggaagtcctggagacaccatgacact
gggagtctccgtccaccccatatcctgggtcccagaactgacctttccaagagcctgcat
cacaggctggacctaagactccagagccctcaggggccccaggcacttaaggaggccaag
gcagttgtgcccttccttggggttggcttctccagtctggacatgagcctctgcgtggtg
ctctacgtggcctcctccttgttcctgatgatcatgtacttcttcttcagagtgaggtcc
aagcgatggaaagtccggctctaccacccagctgtgtag

DBGET integrated database retrieval system