KEGG   Mus musculus (house mouse): 22764
Entry
22764             CDS       T01002                                 
Symbol
Zfx, Zfx5, Zfx5,6, Zfx6
Name
(RefSeq) zinc finger protein X-linked
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Zfx_Zfy_act zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zinc_ribbon_15 zf-C2H2_11 zf-BED ZU5
Other DBs
NCBI-GeneID: 22764
NCBI-ProteinID: NP_001037851
MGI: 99211
Ensembl: ENSMUSG00000079509
UniProt: P17012 B1ASD1
Position
X:complement(93118237..93194250)
AA seq 799 aa
MDEDGLELQQQAPNSFFDATGAGATHMDGNQIVVEVQETVYVSDVVDSDITVHNYVPDDP
DSVVIQDVIEDVVIEDVQCTDIMDEADVSETVIIPEQVLDSDVTEEVSLTHCTVPDDVLA
SDITSASISMPEHVLTSESIHVSDVGHVEHVVHDSVVEAEIVTDPLAADVVSEEVLVADC
ASEAVIDANGIPVNQQDEEKNNCEDYLMISLDDAGKIEHDGSSGLTMDNETEIDPCKVDG
TCPEVIKVYIFKADPGEDDLGGTVDIVESEPENEHGVELLDPNNSIRVPREKMVYMAVND
SQQEEEELNVAEIADEVYMEVIVGEEDAAAAAAAAVHEQQVEDNEMKTFMPIAWAAAYGN
NSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGHPLTVYP
CMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEK
AIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNF
PHICVECGKGFRHPSELKKHMRIHTGEKPYECQYCEYRSADSSNLKTHVKTKHSKEMPFK
CDICLLTFSDTKEVQQHALVHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDM
CDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCRK
GFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFR
RPSEKNQHIMRHHKEVGLP
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggatgaagatggacttgaattacaacaacaagcaccaaactcattttttgatgcaaca
ggagctggtgctacacacatggatggtaatcaaattgttgtggaagttcaagaaacggtt
tatgtgtcagatgttgtggattccgacataaccgtacataactatgttcccgatgaccca
gattcagttgtcatccaggatgtcattgaggatgttgttatagaagatgtccagtgtaca
gacatcatggacgaagcagatgtatcggaaacagtcatcatccctgaacaagtgctggat
tcagatgtaaccgaagaagtttctttaacacattgcacagttccagatgatgttttagct
tctgatatcacttcagcctcaatatctatgccggaacatgtcttgacaagtgaatctata
catgtgtctgacgttggtcacgttgaacatgtggttcatgatagtgtagtagaagcagaa
atcgtcacagatcctctggccgctgatgttgtctcagaagaagtgttggtagcagactgt
gcctctgaagcagtcatagatgccaacgggatccctgtgaaccagcaggatgaagagaaa
aacaactgtgaggactaccttatgatctctttggatgatgctggtaaaatagaacatgat
ggttcatctggactgactatggacaacgaaacagaaattgacccttgtaaagtggatggc
acttgccctgaagtcatcaaggtgtacatttttaaagctgatcctggagaagatgactta
ggtggaactgtagatatcgtcgaaagtgagcctgagaatgagcatggagttgaactactc
gatccaaacaatagtattcgcgttcccagggaaaagatggtttatatggctgttaacgac
tctcagcaagaagaagaagaactgaatgtcgctgagattgctgatgaagtttatatggaa
gtgattgttggagaggaggatgctgcagctgcagccgcagccgcagtgcatgaacagcaa
gtggaggacaacgaaatgaaaaccttcatgccgattgcatgggcagctgcttacggtaat
aattctgatggaattgaaaaccggaatggcactgcaagtgccctcttgcacatagatgag
tctgctggcctcggcagactggctaaacaaaaaccaaagaaaaggagaagacctgattcc
aggcagtaccaaacagcaataattattggcccagatggacatcctctgactgtctaccct
tgcatgatttgtggcaagaagtttaaatcgagaggtttcttgaaaagacacatgaaaaac
catcctgaacaccttgccaagaaaaagtaccgctgtactgactgtgattacactaccaac
aagaagataagtttacacaatcacctggagagccacaagctaaccagcaaggcagagaaa
gccatagaatgcgatgagtgcggaaagcatttctctcatgctggcgctttgtttacccat
aaaatggtgcataaggaaaaaggagccaacaaaatgcacaagtgtaagttctgtgaatat
gaaacagctgaacaaggcctattgaatcgccatcttttggcagtccacagcaagaatttt
cctcacatttgtgtagagtgtggcaaaggtttccgccatccgtcagagctcaaaaagcac
atgcgaatccatactggagaaaagccctatgaatgccagtactgcgaatacaggtctgca
gattcttctaacttgaaaacccatgtaaaaactaagcatagtaaagagatgccattcaag
tgtgacatttgtcttctgactttctcagataccaaagaggtgcaacaacatgctcttgtc
caccaagagagcaaaactcaccagtgtttgcattgtgatcacaagagttcaaactcaagt
gatttgaaacgacacataatttcagttcatacgaaggactatcctcataagtgtgacatg
tgcgataaaggctttcataggccttcagaactcaagaaacatgtggctgcccacaagggt
aaaaaaatgcaccagtgtagacattgtgactttaagattgcagatccgtttgtactaagt
cgccatattctctcggttcatacaaaggaccttccatttaggtgtaagagatgtagaaaa
ggatttcggcaacaaagtgagcttaaaaagcatatgaagacccacagtggccggaaagtg
tatcagtgtgagtactgtgaatatagcactacagatgcctcaggctttaagcggcacgtt
atctccattcatacgaaagactatcctcaccgctgtgagtactgcaagaaaggattccga
agaccctcggaaaagaaccagcacataatgcgacatcataaagaagttggcctgccctaa

DBGET integrated database retrieval system