KEGG   Mus musculus (mouse): 227644
Entry
227644            CDS       T01002                                 

Gene name
Snapc4, 5730436L13Rik
Definition
(RefSeq) small nuclear RNA activating complex, polypeptide 4
  KO
K09453  snRNA-activating protein complex subunit 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    227644 (Snapc4)
   03021 Transcription machinery [BR:mmu03021]
    227644 (Snapc4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-like factors
    227644 (Snapc4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    snRNA-activating protein complex (SNAPc)
     227644 (Snapc4)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 SLIDE SANT_DAMP1_like
Other DBs
NCBI-GeneID: 227644
NCBI-ProteinID: NP_758842
MGI: 2443935
Ensembl: ENSMUSG00000036281
Vega: OTTMUSG00000012774
UniProt: Q8BP86
Position
2; 2 A3
AA seq 1325 aa
MDIDAEREKITQEIQELERILYPGSTSVHFEVSESSLSSDSEADSLPDEDLETAGAPILE
EEGSSESSNDEEDPKDKALPEDPETCLQLNMVYQEVIREKLAEVSQLLAQNQEQQEEILF
DLSGTKCPKVKDGRSLPSYMYIGHFLKPYFKDKVTGVGPPANEETREKATQGIKAFEQLL
VTKWKHWEKALLRKSVVSDRLQRLLQPKLLKLEYLHEKQSRVSSELERQALEKQIKEAEK
EIQDINQLPEEALLGNRLDSHDWEKISNINFEGARSAEEIRKFWQSSEHPSISKQEWSTE
EVERLKAIAATHGHLEWHLVAEELGTSRSAFQCLQKFQQYNKTLKRKEWTEEEDHMLTQL
VQEMRVGNHIPYRKIVYFMEGRDSMQLIYRWTKSLDPSLKRGFWAPEEDAKLLQAVAKYG
AQDWFKIREEVPGRSDAQCRDRYIRRLHFSLKKGRWNAKEEQQLIQLIEKYGVGHWARIA
SELPHRSGSQCLSKWKILARKKQHLQRKRGQRPRHSSQWSSSGSSSSSSEDYGSSSGSDG
SSGSENSDVELEASLEKSRALTPQQYRVPDIDLWVPTRLITSQSQREGTGCYPQHPAVSC
CTQDASQNHHKEGSTTVSAAEKNQLQVPYETHSTVPRGDRFLHFSDTHSASLKDPACKSH
TLMKERPKQPLLPSSRSGSDPGNNTAGPHLRQLWHGTYQNKQRRKRQALHRRLLKHRLLL
AVIPWVGDINLACTQAPRRPATVQTKADSIRMQLECARLASTPVFTLLIQLLQIDTAGCM
EVVRERKSQPPALLQPGTRNTQPHLLQASSNAKNNTGCLPSMTGEQTAKRASHKGRPRLG
SCRTEATPFQVPVAAPRGLRPKPKTVSELLREKRLRESHAKKATQALGLNSQLLVSSPVI
LQPPLLPVPHGSPVVGPATSSVELSVPVAPVMVSSSPSGSWPVGGISATDKQPPNLQTIS
LNPPHKGTQVAAPAAFRSLALAPGQVPTGGHLSTLGQTSTTSQKQSLPKVLPILRAAPSL
TQLSVQPPVSGQPLATKSSLPVNWVLTTQKLLSVQVPAVVGLPQSVMTPETIGLQAKQLP
SPAKTPAFLEQPPASTDTEPKGPQGQEIPPTPGPEKAALDLSLLSQESEAAIVTWLKGCQ
GAFVPPLGSRMPYHPPSLCSLRALSSLLLQKQDLEQKASSLAASQAAGAQPDPKAGALQA
SLELVQRQFRDNPAYLLLKTRFLAIFSLPAFLATLPPNSIPTTLSPDVAVVSESDSEDLG
DLELKDRARQLDCMACRVQASPAAPDPVQRAPSPGEVSAPSPLDASDGLDDLNVLRTRRA
RHSRR
NT seq 3978 nt   +upstreamnt  +downstreamnt
atggacatagacgccgaacgagagaaaataacacaggagatccaggagcttgaaaggatt
ttgtatcctggatccaccagcgtccactttgaagtctctgaatccagtctcagttcagac
tctgaagcagattcgctgcctgatgaggacttggaaactgctggtgcccccatcttggaa
gaggaagggtcgagtgagagcagcaatgatgaggaggaccccaaggacaaagctctccct
gaagaccccgagacctgtctgcagctaaatatggtctaccaggaggtgatccgggaaaag
ctagcagaggttagccagttgctagcccagaaccaggagcagcaggaagagatcctgttt
gatctgtctggaaccaaatgccccaaggtgaaggatggcagaagtctgccctcatacatg
tacataggccacttcctgaagccatacttcaaggacaaggttactggagtggggcctcct
gccaacgaagaaacacgggagaaggctacccagggaatcaaggcctttgaacagctcttg
gtgaccaagtggaagcactgggagaaagccttgctcaggaagtctgtagtgagtgaccgc
ctacaacgtctgcttcagcccaaattgctgaagctggagtacttacacgaaaaacagagc
cgagtctccagtgagttggaaaggcaggccctggagaagcagattaaggaagcagagaag
gagattcaggacatcaaccagctcccagaggaagcattgttggggaaccggctagacagc
cacgactgggagaagatttccaatattaactttgaaggagcccgcagtgcagaggagatc
cggaagttctggcagagttctgagcatccaagcatcagtaagcaggaatggagcacagaa
gaagtagagaggctgaaggccatcgctgccacacatggccacctggagtggcacttggtt
gcagaggaacttgggacaagccgcagtgcctttcagtgcctgcagaaattccagcagtac
aacaaaaccctgaaacgcaaggagtggacagaagaggaagaccacatgctcacccagctg
gtccaagagatgcgagttgggaaccatatcccataccgcaagatcgtctacttcatggaa
gggagagactccatgcagctgatctaccgttggaccaagagcttagatcccagcctgaaa
aggggattctgggccccagaggaagatgctaaattgcttcaagctgttgccaagtatggg
gcgcaggactggtttaaaatccgggaagaggtgccaggtaggagcgatgcccaatgcaga
gaccgctacatcagaagattacatttcagcttgaaaaagggacggtggaatgcaaaagaa
gaacaacagctgatccagctaatagagaaatatggtgttggtcactgggcaagaatcgct
tctgaattgccccatcggtcaggctcccagtgtctgagcaagtggaagatcttggccagg
aagaaacagcatctgcagaggaagagagggcagaggccccgtcacagtagccagtggagc
tctagcggcagcagcagcagcagcagtgaagactacggcagcagcagtggcagcgacggc
agcagcggcagtgaaaactcagatgtggagctggaggcgtctctggagaagagtagagca
ctgactcctcaacagtacagagtgccagacattgacctgtgggttcctaccaggctgatc
accagccagtcacagagagaagggacagggtgctacccacaacaccctgctgtctcctgc
tgcactcaggatgcctctcaaaatcaccacaaggaaggttctaccaccgtctctgctgct
gagaaaaaccagctgcaggtgccctatgagacccacagcactgttccaagaggagaccgg
ttcctacacttctcggacacccactcagcaagtttgaaggatccggcctgcaagagtcac
acactgatgaaggaaagaccgaagcagccactcctccctagttcacgctcagggtctgac
cctggcaacaatacggctgggccccatctgcggcagctatggcatggaacttaccagaat
aagcagagacgcaagagacaggctctacatcgcaggctccttaagcacaggcttttgctg
gctgtgataccctgggtgggtgacatcaacctggcctgcacacaagctccccggagacct
gcaaccgttcagactaaagctgacagcatccggatgcagttagagtgtgcccgcctggcc
agcactccggtattcacactgcttattcagctattgcagattgatactgcgggctgcatg
gaggtggttcgagagaggaaaagccagccccctgcactgctccagcctggcacccggaac
acccagccgcatctcctgcaggcatcctctaatgccaagaacaacacaggctgcctccca
agcatgacgggggaacaaactgcaaagagagccagccacaaagggcgcccacgactgggg
tcatgcaggactgaggctacccccttccaagtccctgtagcagccccacgtggcctccgg
ccaaagcctaagactgtttctgagctgcttcgggagaagcggctccgtgagtcccatgcc
aagaaggccactcaggctcttggtctcaacagccagctgctggtctcctcacctgtgatc
ctccagccccctctgctgccagtcccccatggttccccagtagtaggccctgcaacgtcc
agtgtagaactctctgtacctgtggcgccggtgatggtcagttcaagtccttctggctcc
tggccggtgggtgggatctcagccacagacaagcagccccccaacctacagaccatttcc
ctaaatcctccccacaaagggacccaggttgcagcccctgctgcttttaggagcctagcc
ttagcccccgggcaagtccccacaggcggccatctgagtactctaggacagacctctacc
acatcccagaagcagagcctgcccaaggtcctgcccattcttcgagctgctcccagcctc
actcagctgtctgtgcagccaccagtaagtggacagcccctggcaaccaagtccagcctg
cctgtcaactgggttctcacaactcagaagttgctctctgtccaagtgccagctgtggtg
ggcctcccccagtcagtgatgacccctgagaccataggactacaagcaaaacagctgcct
tcccctgccaagactcctgcttttctggaacagcctccagccagtacagacacagaaccc
aagggacctcagggccaggaaataccacccacacctgggcccgaaaaggcagctttggac
ctaagtctcctttcccaggaaagtgaggcagccatcgtcacatggctgaaggggtgccaa
ggtgcttttgtacccccgctggggagcaggatgccctatcatcccccttccctgtgcagc
ttgcgggcattgtccagcctcctcctccagaaacaggacttggagcagaaggcttcctct
ctggcggccagccaggcagctggggcccaacctgatcccaaggctggagccctacaagct
tccctggagctggtacagaggcaattccgggacaacccagcctacctcctgctaaagacg
cgtttcctggctatcttctcccttcctgcattcctggccactctgccccccaacagcatc
cccaccaccctgtcaccagacgtggctgtggtttctgagagtgacagtgaagacctcggt
gacttggagctcaaggatagggctagacagttggactgcatggcctgcagagtgcaagca
agcccagcagccccagaccctgtacagagagctccaagtcctggtgaggtttctgctccc
tcccctctggatgcttctgatggccttgatgaccttaacgtgctcaggactcgacgtgct
cggcattcccggagatag

DBGET integrated database retrieval system