KEGG   Mus musculus (mouse): 227659
Entry
227659            CDS       T01002                                 

Gene name
Slc2a6, A330096C23, F630103L12Rik, GLUT-6, Glut6, Glut9
Definition
(RefSeq) solute carrier family 2 (facilitated glucose transporter), member 6
  KO
K08144  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    227659 (Slc2a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   227659 (Slc2a6)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    227659 (Slc2a6)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 227659
NCBI-ProteinID: NP_766247
MGI: 2443286
Ensembl: ENSMUSG00000036067
Vega: OTTMUSG00000011843
UniProt: Q3UDF0
Position
2; 2 A3
AA seq 497 aa
MQEPLLRTEGLDYDTFPEVPATPGERERAGALKNRRVFLATFAAVLGNFSFGYALVYTSP
VIPELKLSSDPALHLDKIQASWFGSVFTLGAAAGGLSAMLLNDLLGRKLSIMFSAVPSAI
GYAIMAGARGLWMLLLGRMLTGFAGGLTAACIPVYVSEIAPPDVRGALGATPQLMAVFGS
LSLYALGLLLPWRWLAVAGEGPVLIMILLLSFMPNSPRFLLSKSRDEEALQALTWLRADS
EVHWEFEQIQDNVRRQSSRVSWAEAREPRVYRPVLIAVLMRFLQQLTGITPILVYLQTIF
DNTSVVLPSQQDAAIVGAVRLLSVLIAAVTMDLAGRKVLLYVSASVMFAANLTLGLYVQF
VPRPLTPNSTVEIVTLGDTAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRAR
GVASGLCVLVSWLTAFVLTNYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRS
LEQIEAFFHTRRMSFRP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgcaggaacccctgctaagaaccgagggactcgactatgataccttccccgaggtgccc
gcgactcctggagagagagaacgagccggggccttgaaaaacagaagggtgttcctggct
accttcgccgctgtgctgggcaatttcagctttgggtatgccttggtctacacatctcca
gtcatccctgaactgaagctctcttctgacccagcactacacctggacaaaatccaggca
tcctggtttgggtccgtgttcaccttgggtgccgcagcagggggcctcagtgctatgtta
ctcaatgacctcctgggccggaagctcagcatcatgttctcagctgtcccctcagccatt
ggctatgcaatcatggccggtgcccgtggcctctggatgcttctgttggggaggatgctg
acgggctttgccgggggactcactgctgcctgcatcccggtgtacgtgtctgagattgca
ccccctgatgttcgtggggccctgggggccacaccgcagctcatggccgtgtttggatcc
ctgtctctctacgcccttggtctgctgctaccttggcgatggcttgctgtggctggagag
gggccggttctcatcatgatcctgctgctcagcttcatgcccaactctcctcgcttcttg
ctctcaaagagccgggatgaggaggcactgcaggcgctgacctggctgcgagctgactcc
gaggtccattgggagtttgagcagatccaggacaacgtgcggagacagagtagccgagtg
tcgtgggcggaagcccgggaaccccgtgtgtaccggcctgttctcattgcagtactgatg
cgctttctgcagcagctgacaggcatcacacccatcctggtgtacctacagaccatcttc
gacaacacatccgtggtgctgccctcccagcaggatgcagcgatagttggtgctgtgagg
ctcctatctgtgctgattgctgctgtcaccatggacctggcgggccgaaaagttctgctc
tatgtgtcagcatccgtcatgtttgctgccaacctgacactggggctctacgtccagttt
gtgccaaggcctctgacccccaacagcactgtggagatcgtgaccctgggggacacagcc
ttcaactatcttaccctgatacccctgctggccaccatgctcttcattatgggctatgcc
atgggctggggtcccatcacctggctcctcatgtctgaggttctgcccttgcgtgcccgt
ggtgtggcctcagggctctgcgtgctggtcagctggctcacagccttcgtcctcactaac
tacttcctgctggcagtgaatgccttcggcctccaggtgcctttcttcttcttctcggcc
atctgcctgctcagcttgctcttcacaggctgctgtgtgcctgagaccaggggccgctcg
ctggagcagatcgaggccttcttccacactcgcaggatgtccttcaggccctag

DBGET integrated database retrieval system