KEGG   Mus musculus (mouse): 227693
Entry
227693            CDS       T01002                                 

Gene name
Zer1, C230075L19Rik, Zyg11bl
Definition
(RefSeq) zyg-11 related, cell cycle regulator
  KO
K10350  Zyg-11 protein homolog
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    227693 (Zer1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     227693 (Zer1)
SSDB
Motif
Pfam: Arm HEAT_EZ
Other DBs
NCBI-GeneID: 227693
NCBI-ProteinID: NP_848809
MGI: 2442511
Ensembl: ENSMUSG00000039686
Vega: OTTMUSG00000016742
UniProt: Q80ZJ6
Position
2; 2 B
AA seq 779 aa
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDQLVNEYVELVSA
ACTFEPHETFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFRHSLVSLSLSGCANIFYEEDNPGGCEDECLVNPTCQVLVKDFTFEGFSRLRFL
NLGRMIDGIPVESLLRPLNSLAALDLSGIQTSDATFLTQWKDSLMSLVLYNMDLSDDHIR
VIVQLHKLRSKILTCGPHLISSHLDISRDRLSSYYKFKLTRKVLSLLVQKLGNLMSLDIS
GHMILENCSISKTDEEAGQTSTEPSKSSIMPFRALKRPLQFLGLFETSLCRLTHIPAYKV
SGDKNEEQVLNAIEAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYD
KNIQVTGSAALFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSI
PEELEFQYRRVNELLLGILSPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTM
LKLIQKKLLDKTCDQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQEL
HRNMLGLLGNVAEVKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPE
AWGVCEPQRAEVEDRMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALY
NLVSVYPDKYCPLLIKEGGMPLLRDLIKMATARQETKEMARKVIEHCSNFREENMDTSR
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggcgtctgacacgcccgagtccctgatggccctctgtactgacttctgtctccggaat
cttgatggcaccctgggctacctcctggacaaagagaccctgcggctgcatccagacatc
ttcttgcccagtgaaatctgtgaccagctggtcaatgagtatgtggagctggtcagtgct
gcctgcacttttgagccacacgagactttcttcagcctcttctcagacccccgcagtact
cggctcactcgcatccaccttcgtgaggacctggtgcaggaccaggacctggaagccatt
cgcaaacaggacctggtggagctctacctgaccaactgcgagaagctgtccgccaagagc
ctgcagacactgcggagcttccgacacagtctggtgtccttgagtctctccggctgtgcc
aacatcttctatgaggaggacaacccaggcggctgtgaggatgagtgcctggtcaacccc
acctgccaggtgctggtcaaggacttcaccttcgagggcttcagccgcctgcgcttcctc
aacctgggccgcatgattgacggtatccccgtagagtcactgcttcggccactcaactcc
ctggccgccttggacctctcaggcatccagacaagtgatgccactttcctaacacagtgg
aaggacagtctgatgtcccttgtgctctacaacatggacctttcagatgaccacatccgt
gtcattgtccagctgcacaagctgcggagtaagatcctgacctgtggtccccacctgatc
tccagccacctggacatctcccgagaccgcctctccagctactacaagttcaagctgact
cggaaggtgctcagcctcctagtgcagaagctggggaacctaatgtcactggacatctct
ggtcacatgatcctagagaactgcagcatctccaagacagatgaggaggcagggcagacc
agcaccgagccatccaagagcagcatcatgcccttccgggctctgaagaggccactgcag
ttccttgggctctttgagacctcattgtgtcgtcttacgcacattccagcctacaaagtg
agtggtgacaaaaatgaagagcaggtgctgaacgccatcgaggcctacacagagcaccgg
cccgagatcacatccagggccatcaacctgctgtttgacattgcacgcattgaacgctgc
aaccagcttctgcgggccctgaagctggtcatcacagccctcaagtgtcacaagtatgac
aaaaacattcaagtgaccggcagtgctgccctcttctacctgaccaactccgagtaccgc
tcggagcagagcgtcaagttgcggcggcaggtcatccaggtggtgctgaatggcatggag
tcctaccaggaggtgacggtgcagcggaactgctgtctgaccctctgcaacttcagcatc
cccgaggaactggagttccagtaccgccgggtgaacgagctgctgctgggcatcctcagc
cccacgcgtcaggacgagtcaatccagcggatcgctgtgcacttgtgcaatgccctggtc
tgccaggtggacaatgaccataaggaggctgtaggcaagatgggcttcgtcgtgaccatg
ttgaagctgatccagaagaaactgctggacaagacgtgtgaccaggtcatggagttctcc
tggagtgctctgtggaacatcacagatgagacacctgacaactgcgagatgttcctcaac
ttcaatggcatgaagctctttctcgactgcctgaaggagttcccagagaagcaggagcta
caccgtaacatgctagggctcttggggaatgtggcagaggtaaaggagctgcgacctcag
ttgatgacctcccagttcatcagcgtcttcagcaacctgctggagagcaaggccgacggc
attgaggtttcttacaacgcctgtggtgtcctctctcacatcatgtttgatgggcctgag
gcctggggtgtctgtgaacctcagagggcagaggtggaggatcgtatgtgggcggccatc
cagagctgggatatcaactcccgaaggaatatcaactacaggtcctttgagccaatcctc
cgcctccttccccagggtatttctccagtcagccagcactgggccacctgggccctgtac
aacctcgtgtctgtctaccctgacaagtactgccccctgctgattaaagaaggtgggatg
cccctgctgagagacttgatcaagatggcaactgcccggcaggaaaccaaggagatggcc
cgcaaggtgattgagcactgcagtaactttagagaggagaacatggacacgtccagatag

DBGET integrated database retrieval system