KEGG   Mus musculus (mouse): 227695
Entry
227695            CDS       T01002                                 

Gene name
Spout1, 9930028P05, AL033358, CENP-32, D2Wsu81e
Definition
(RefSeq) SPOUT domain containing methyltransferase 1
  KO
K09142  methyltransferase [EC:2.1.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    227695 (Spout1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     227695 (Spout1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    227695 (Spout1)
SSDB
Motif
Pfam: Methyltrn_RNA_3 DUF2514
Other DBs
NCBI-GeneID: 227695
NCBI-ProteinID: NP_766248
MGI: 106544
Ensembl: ENSMUSG00000039660
Vega: OTTMUSG00000016747
UniProt: Q3UHX9
Position
2 B; 2 21.29 cM
AA seq 385 aa
MAERPRKRPCGPGEHGQRVEWRKWKQQKKEEKKKWKDLKIMKKLERQRAQEEEAKRQEEE
EEAAAQRSNQGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDEEG
QDTKSVEGEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPH
HMRQDEESEFREGVVVDRPTKAGHGSLVNCGMKKEVKIDKKLDPGLRVTVRLNQQQLPEC
KTYKGTVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASA
QLPSFRHALVVFGGLQGLEAAVDADPNLEVADPSVLFDFYVNTCLSQGSRTIRTEEAILI
SLAALQPGLTQVGSRPASPLSGPRM
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcggagcgcccgaggaagcgtccgtgtggtccgggtgaacatggccaaagggttgaa
tggcgaaaatggaaacagcagaaaaaagaggagaaaaagaagtggaaggacctcaagata
atgaagaaactggagcggcagcgtgcccaagaggaagaggctaaacgccaggaagaggag
gaagaggcggcggcccagaggagcaaccaaggacggccttacactctgagtgtggccctg
ccaggctccatcctggacaatgcccagtcacctgagctccgcacctacctggctggccag
atcgccagagcctgcaccatcttctgtgtggatgagattgtggtgttcgatgaggagggc
caagataccaagagtgtggaaggagaattcaggggagttggcaagaaagggcaggcatgt
gtccagctggcccgcatcctacagtacctggagtgtccacagtacctgagaaaggcgttc
ttccccaagcaccaagatctgcagtttgcaggaatcctcaaccccttggacagccctcac
cacatgcgtcaggacgaagagtctgagtttcgagaaggcgtcgtggtggaccggcccacc
aaggcaggccatggctctttggtcaactgtggaatgaagaaggaggtgaagattgacaag
aaactggaccctggacttcgggtgaccgtgcgactgaaccagcagcagctcccagaatgc
aagacatacaaaggaacagttgtgtcatcacaggacccccgcaccaaagctggtctctac
tggggctacactgtccggctggcctcttgcctcagcgctgtgtttgctgaggctcccttc
caggatgggtacgacctgaccattgggacatcagaacgtggctccgacgtggcctctgcc
cagctgcccagcttcaggcatgcccttgtggtgtttggaggcctccaagggctagaagct
gcagtggatgctgacccgaaccttgaagtggctgaccccagtgtcctcttcgacttctat
gtcaacacatgccttagccagggcagccgtaccatccgcaccgaggaggccatactcatc
tcgctggctgctctgcagcctggtctcacccaggtgggatcgaggcccgcctccccgctt
tctggacccaggatgtag

DBGET integrated database retrieval system