KEGG   Mus musculus (mouse): 227720
Entry
227720            CDS       T01002                                 

Gene name
Nup214, BC039282, CAN, D2H9S46E
Definition
(RefSeq) nucleoporin 214
  KO
K14317  nuclear pore complex protein Nup214
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    227720 (Nup214)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    227720 (Nup214)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    227720 (Nup214)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     227720 (Nup214)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 dCache_2
Other DBs
NCBI-GeneID: 227720
NCBI-ProteinID: NP_758472
MGI: 1095411
Ensembl: ENSMUSG00000001855
Vega: OTTMUSG00000012954
UniProt: Q80U93
Position
2 B; 2 21.97 cM
AA seq 2085 aa
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSVLTISNKYGMLFAGGTNGLN
VFPTKSLLIQNKPGDDPNKIVDTIQGLNVPMKFPVHHLALSCDSLTLSACMMSSEYGSII
AFFDVRTFSNQAKPLKRPFTYHKVSNDASGMVNDMKWNPTVPSMVAVCLADGSISVLQVT
DVVKVCATLPPSTGVTCVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHP
VRVLDVLWIGTYVFTIVYAGADGTLETCPDVVMALLPKKEEKHPEIFVNFMEPCYSSCTE
RQHHYYLSYIEEWDLVLAASAASTEVSILARQNDQTNWESWLLEDSSRAELPVTDKSDDS
LPMGVAIDYTNEVEVTINEEKTLPPAPVLLLLSTDGVLCPFYMINQNPGVRSLIKTLELI
STEGERQPKSSGSFPGTPSSPQAPQNLDAPATASSPLPPVSAAPTSTFPMPSAAGSPSVF
SFGPSSFKSSASVTGEPPLYPTGSDSSRAAPGSGTSTFSFAPPSKGSLASTPAVAPVATS
AAPFTFGFKPTLESTPMSSTPNTGMKPSFPPSASSVKVNLNEKFTAVASSAPVHSSTSTP
SVLPFSSSPKPTASGPLSHPTPLPASSSSMPLKSSVSPSPAAGRSTQTAPSSAPSTGQKS
PRVNPPVPKSGSSQAKALQPPVTEKQRPQWKDSDPVLAGIGEEIAHFQKELEELKARTAK
ACLQVGTSEEMKMLRTESDDLHTFLFEIRETTESLHGDISTLKTTLLEGFAGVEEAREQH
GRNHDSGYLHLLYKRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDRHLEQKKRQ
RRLIVPERETLFNTLANNREIINQQRKRLNQLVDSLQQLRLYNHTAPWSLPSALSTQSNS
HSFDSDLECLLKTTIESHTKPSPRVPGKLSPAKQAQLRNFLAKRKTPPVRSTAPASLSRS
AFLSQRYYEDLDEGSSASSVAQPLEGEDARPTCTSVAQPLEGEDAQPICKEEEAVVPVPR
HAPVVRTPSIQPSLLPQSMPFAKPHLIHSSSPAVMSSAVSTSATKVIPQGADSTMLATKT
VKHGAPGPSHTVAAPQAAAAAALRRQMASQAPAMSTLTESTLKTVPQVVNVQELRSNPSP
PSAAMGSAVQHSAAKTPHAVLTPVANSQAKQGSLINSFKPSGPTAASCQLSSGDKAVGQG
TAKTESAATSTPSAAGQLNKPFSFASPGTFTFGTITPTPSSSFTATPGAGPPTKEPTQLE
AFSFGGGGKPFSEAIPGNSPATGATSAPSTSVTAASLEDSAPSSSKPAAPPETTVSSASS
KLETPPSKLGELLFPSSLAGETLGSFSGLRVGQAEDSTKPVSKASSTNLAGAQPAKPSGV
SFPNTSVLGKPVEPAVTSSVSPAPAAPASALNVSTSSSSATVFGSVPLTSAGPPGLISFG
GAALASSKASFSFGNQQTSSSTASSATPTSTSVAPSLPASFPTLSFGGLLSSPSASSLPV
SSGKSTEEAAPPAVPDKSDSSEVSATTPSLPVQPQSTQASLQTSDPVKKEPVLVQTTDSS
PSRPASSASFVASTESMPVTLGAPDSKIEAVSPASTFAGPGQAAVATAVLPGAGSAATEA
SGTPTTSTVSSSSPTSATETAVFGTATSGSSVFTQPPAASSSSAFSQLSSNTATAPSATP
VFGQVAASITSTAAATPQASSSGFGSPAFGASAPGVFGQTAFGQTPAFGQATSSPASGFS
FSQPGFSSVPAFGQSVSSTPASTSANVFGATSSTSSPGSFSFGQASTNTGGTLFGQNNPP
AFGQSPGFGQGSSVFGGTSATTSTAAPSGFSFCQASGFGSSNTGSVFGQAANTGGSVFGQ
SSTSSGGVFGSGNATRGGGFFSGLGGKPSQDAANKNPFSSAGGGFGSTAAPNTSNLFGNS
GAKTFGGFGSSSFGEQKPAGTFSSGGGSVASQGFGFSTPNKTGGFGAAPVFGSPPTFGGS
PGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSGNTASFGTLASQNAPT
FGSLSQQTSGFGTPSSGFAGFGSGTGAFTFGSSNSSVQGFGGWRS
NT seq 6258 nt   +upstreamnt  +downstreamnt
atgggagacgagatggatgccatgatccctgagcgggagatgaaggactttcagtttaga
gcactgaagaaagtgaggatctttgactctcctgaagagttgcccaaggagcgctcgagt
gtgcttaccatatccaataagtatggtatgctcttcgctggtggcaccaatggcttgaat
gtttttcctactaaaagccttcttatccaaaataaacctggagatgatcccaataaaatt
gttgacacaattcaaggcttgaatgttcctatgaaattcccagtccatcacctagcactg
agctgtgatagtcttacactctctgcctgcatgatgtctagtgaatacggctccattata
gctttttttgatgttcgcacattttcaaatcaggctaaaccattgaaacgtccatttacc
tatcacaaggtttcaaacgatgccagcggaatggtgaatgatatgaagtggaaccccact
gtcccttccatggtggcagtttgtctggctgatggcagtatttctgtcttgcaagttaca
gatgtggtgaaagtatgcgccacacttcctccttccacaggagtcacatgtgtatgctgg
agccccaaaggaaagcagctggcagtaggaaagcagaatggaactgtggtccagtacctt
cctactttgcaggaaaaaaaggtcattccatgtcctccattttatgagtcagatcatcct
gtcagagttctggatgtgctatggattggtacatatgtcttcacgatagtctatgctggt
gcagatggaaccttggagacctgtccagatgtggtgatggctctactcccgaaaaaagaa
gaaaagcatccagaaatatttgtgaacttcatggagccctgctacagcagctgcacagag
agacaacatcattactacctcagctacatcgaggagtgggatttagtgctggcagcatct
gcagcttctacagaagttagcatccttgctcgacaaaatgatcagactaattgggaatct
tggctgctggaggactctagtcgagctgaactgcctgtgacagacaagagtgatgactcc
ttgcccatgggtgttgccatagattataccaatgaagtggaagtcaccatcaatgaagaa
aagactcttccgcctgctccggttctcctgttactttcaacagatggtgtgctttgtcca
ttttatatgatcaaccaaaatcctggggttaggtccctaatcaagaccttggaactgatc
tcaacagaaggagagcgacagcctaagtcctcaggaagttttcctggtactccatcttcc
cctcaagctccacaaaacctggacgctccagcaacagcctcttcgcctcttccacctgtg
tccgctgctcccacctccaccttccctatgccctctgctgcaggaagcccttctgtgttc
tcctttggcccttcatccttcaagtcttctgcttctgtcaccggggagcccccactgtac
cccactggctccgacagctccagagcagcaccaggctctggcacctccactttctctttt
gctcctccttccaaaggctccctggcgtcgacccctgcagtggctcctgtggccacatct
gctgctcccttcacttttggttttaagcccaccttggaaagcacacctatgtccagtacc
ccaaacacagggatgaagccttcgttccctccctcggcctcttcggtgaaagtcaacctg
aatgagaagttcaccgctgtggcctcctctgcacctgttcatagctccacgagcacaccc
tccgtgttgccgttctcctcctccccgaagccaacggcttctggaccactcagccatcct
acgcctctcccagcatcatccagctccatgcctttgaagtcttcggtctctccctcgcca
gcagctggccgctccactcagactgcgccaagttcagcaccctccacagggcagaaatca
cccagggtaaaccctccagtgccaaagtcaggttcttctcaggccaaggcacttcagcct
cctgtcacagagaaacagaggcctcagtggaaagactcagaccccgtgctggctgggatt
ggagaggagattgcacacttccagaaagaactagaggagttaaaggcccggaccgccaaa
gcctgtctccaggttggcacctcagaagagatgaagatgctgcggacagagtcagatgac
ttgcacacctttctttttgagattagagagaccacagagtctcttcatggagacataagt
actctgaaaacaactttgctggagggctttgctggggtcgaagaagccagagaacagcac
ggaagaaatcacgactctgggtatctccacctgctttataaaagaccgctggatcccaag
agcgaggcccagctccaggaaattcgccgccttcaccagtacgtgaaatttgctgtccag
gatgtgaatgacgtcctagacttagagtgggatcggcatctggagcagaagaagagacag
aggcgcctaattgtgccagaacgagagacacttttcaacacgctagccaacaaccgggag
atcatcaaccagcagaggaagaggctgaatcagctggtggacagtctgcagcagctccgt
ctctataaccacacggccccgtggagcctgccctcagcgctctcaactcagagcaacagt
cacagttttgacagtgaccttgaatgcctgctaaaaactaccattgaatctcacaccaag
ccttctcccagagtgccaggtaaattgtccccggcgaaacaggcccaactgaggaacttc
ttggccaaaaggaagaccccaccagtgaggtctactgctccagccagcctgtcccggtca
gccttcctatctcagaggtactatgaagacttagatgaaggcagctccgcgtcatccgta
gctcagcctctggagggagaagatgcccggccaacctgcacatctgtagctcagcctctg
gagggagaagatgcccagccaatctgcaaagaggaagaggctgtggtcccagtacctcgg
catgcccctgtggtccgcacaccttctatccaacccagtctcctgcctcagtcgatgccc
tttgcaaagcctcacctgatccatagttcttcacctgccgtgatgagctctgcagtctct
acgtcagccaccaaagttattcctcagggagcagacagcacaatgctggcaactaaaaca
gtaaagcacggtgcaccaggtccttcccacactgttgcagctccccaggccgcagctgct
gcagccctaagacggcagatggccagtcaggcaccagctatgagcactctgaccgaatca
actctgaagactgtccctcaggtggtgaatgtacaggaactgaggagtaatccctcgccc
ccatctgcggccatgggttctgccgtgcagcactcagcagccaaaacaccccatgctgtg
ttaacccccgtggctaacagccaagccaagcaggggtctctgataaattctttcaagccg
tcaggacccacagcagcatcctgtcagctgtcctctggggataaagctgtaggtcaaggg
acagccaagacagagtccgctgcgacctcgactccatctgctgcaggacagctcaacaag
cctttctcattcgcctccccagggacctttacttttgggacaatcacaccaaccccatct
tctagtttcactgccacaccaggggcaggaccccctactaaagagccaacccagcttgag
gcattctcatttggcgggggaggcaaacctttctctgaggccattcctgggaactcccct
gccacaggagcaacatcggcacccagcacttctgtaacagctgcctctctggaagactct
gctccatccagcagcaaacctgcagctcctcctgaaactactgtgtcctctgcttctagc
aaattggaaactccaccgtccaagttaggagagcttctgttcccaagctctctagctgga
gagacgctggggagcttctcgggcctgcgtgttggccaagctgaggattctactaagcca
gttagtaaggcctcctccacaaacctagctggagcccagccagctaagccctcaggggtt
agctttcctaatacttcagtgttagggaagccagtggagcccgctgtgacctcctctgtg
agccccgccccagcagcaccagcctcagctctgaatgtgagcactagcagttcctcagca
actgtctttggcagtgtgccccttaccagtgctggacctcctgggctcatcagttttggt
ggggctgctttggctagtagcaaagctagtttctcatttggaaaccagcagactagtagt
agtacagcatcatcagctaccccaacatcgacctcagttgccccttcccttccagcatct
ttccctactttgtcatttggtggcctcctgagttcaccatcagcttcttccctgcccgtg
tcctctggtaagagtacagaggaggcagcaccaccagctgttcctgacaagtcagacagc
agtgaagtttcagcaacaacaccctcacttccagtacagccacagtcaacccaggcatct
ctgcaaacttctgaccctgtcaaaaaagaacctgttcttgtgcagaccacagacagcagc
cccagcagaccagcatcttctgccagctttgtggcatccacagagtccatgccagtaacc
ctaggggcccctgacagcaagatagaggcagtgtctcctgcgtccacctttgcagggcct
ggacaggctgctgtggcaacagctgttctcccaggagcaggctcggcagccactgaagca
tcgggtacccctaccacctccactgtctccagcagtagcccaacttctgccacagagaca
gctgtatttgggactgccacatctggttcctcagtctttacacagccacctgctgccagt
tctagctcagcgttcagccagctctccagtaacacagccactgcgccctctgccacccct
gtgtttgggcaagtggcagccagcataaccagcacagccgctgccacaccacaggccagc
agttcagggtttggcagccctgcatttggtgcttcagctcctggagtgttcggacagaca
gcatttgggcagaccccagcctttgggcaagcaacaagcagccctgccagtggcttctcc
ttcagccagcctgggttcagttccgtgcctgctttcggccagtctgtctcctctaccccc
gcatccaccagtgcaaatgtctttggagccacctcgagtaccagcagtcctggttccttc
tcatttggacaggcttctaccaatacaggagggacgctgtttggtcaaaacaaccctcct
gcttttggtcagagccctggctttgggcagggaagctctgtgtttggtggcacctcggcc
actacctctacagcagcaccttcagggtttagcttttgtcaagcctccggttttgggtct
agtaatactggttctgtgtttggccaggcagccaacactggtgggtcagtctttggccag
tcatccacttccagtggtggcgtgtttgggtctggaaatgctacaagagggggcggtttc
ttcagtggccttggaggaaaacccagccaggatgctgccaacaaaaaccccttcagctca
gccggtgggggctttggatctacagctgccccaaatacctctaatctgtttggaaacagt
ggagctaagacatttggagggtttggcagctcatccttcggggaacagaagcctgccggc
acattcagctctggcggtgggagcgtagcatcccaaggttttggattttccactccaaat
aaaacaggtggcttcggtgctgctccagtgtttggcagccctcctacttttgggggatcc
cctgggtttggaggggtgccagcattcggttcagccccagcctttacaagccctctgggc
tcgacgggaggcaaagtgttcggagagggtactgcggctgccagcgcaggcggattcggg
ttcgggagcagcggcaatactgcatccttcggtaccctcgccagtcagaacgcacccacc
ttcgggtccttgtcccagcagacctcaggctttgggaccccgagcagtggattcgctggg
tttggatcgggcacaggagccttcacctttggatcatctaactcgtctgtccagggcttc
ggtggctggagaagctga

DBGET integrated database retrieval system