KEGG   Mus musculus (house mouse): 227733
Entry
227733            CDS       T01002                                 
Symbol
Pip5kl1, BC028795
Name
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase-like 1
  KO
K13712  phosphatidylinositol-4-phosphate 5-kinase-like protein 1 [EC:2.7.1.68]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04144  Endocytosis
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    227733 (Pip5kl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    227733 (Pip5kl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     227733 (Pip5kl1)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 227733
NCBI-ProteinID: NP_937834
MGI: 2448520
Ensembl: ENSMUSG00000046854
UniProt: Q6U7H8
Position
2:32465238..32473799
AA seq 395 aa
MATPSLRSHEIPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMTRMM
QEGLWAATQVSKNNPPTGPTTQKDYLEVMTQVHEEGFELGTLAGPAFARLRKSIGLTEED
YQATLGPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYP
HSLLARLLGVYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEGSPL
VLVLKDLNFQEKTMRLGAQRSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHH
SVFSTFKSIQGVSKSKGTGDQNCRMLPDLPNALHILDGPDQRYFLGLVDMTTVYGFRKRL
EHVWKMVRYPGQSVSTVSPAHYARRLCRWAEVHTE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccacaccaagccttaggtcccacgagatcccggcccactcccaggaggctggaaac
aagtccatttcctcagggagccgccgcggccttctttggcacctccgagccaggcagtct
agagttggcctgtttgaggtcggtccaggacatgagctgcatagaatgacacgaatgatg
caggaagggctgtgggctgccacccaggtctccaagaacaacccacccacgggacctact
acccagaaggattacctggaagtcatgacccaagttcacgaagagggcttcgagctgggc
accttggctggcccggcttttgcacggctgaggaaatccattggcctgactgaagaggac
taccaggctactcttggccctggtgatccctaccttcaattcttcagcacctccaaaagc
aaggccagcttcttcctgacccacgaccagcgcttctttgtgaagacccaacggcgccac
gaagtgcatgtgctgcttgcccacctgccccgctatgtggagcacctgcagcaataccca
cactccctgctggcacggttgctgggcgtatacagtctgcgggtagctcaggggaaaaag
aagtacttcatcatcatgcagtgcatcttctaccctaccagccgcatttctgagaggtat
gacatcaagggctgcaacataagccgctgggtagatccagcccctgagggcagccccctt
gtcttggtgctgaaggacctcaactttcaagaaaagaccatgagattgggagcccagcgg
agctggttcctccggcagatggagctagacaccgccttcctgcgggaggtgaatgtactg
gattacagcctcctggtggccatccagtttctccacgaagacgagaagggcattcaccac
tctgtcttcagcacattcaagtccatacaaggtgtgtcgaagtcgaagggaacgggggac
cagaactgccggatgctgcccgaccttcccaatgccctccatatcttggacgggccagac
caacgctattttctgggcttagtggatatgactaccgtgtatgggtttcgcaaacggctg
gaacatgtgtggaagatggtacgctatccaggccagagcgtctccactgtcagcccggct
cactacgcccgtcgcctctgtcggtgggcagaggtgcacacagaatga

DBGET integrated database retrieval system