KEGG   Mus musculus (mouse): 227736
Entry
227736            CDS       T01002                                 

Gene name
Cfap157, 1700019L03Rik
Definition
(RefSeq) cilia and flagella associated protein 157
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Titin_Ig-rpts
Other DBs
NCBI-GeneID: 227736
NCBI-ProteinID: NP_079895
MGI: 2447809
Ensembl: ENSMUSG00000038987
Vega: OTTMUSG00000012529
UniProt: Q0VFX2
Position
2; 2 B
AA seq 523 aa
MAPKKKPNKGGKEMQGKKIGGKKDASGTKTPELAMVEELKEFYHKQIQDLEDRLARYQRK
WDELAVREKLFHQEFEQLANNKKEIVAFLKRTLNQKVDEITDLNDQLQSLEVAKDMEKDA
FEAQLAQVRHEFQEIKDQLTTENIALGIKLSSLEEFRLQKEELTEKYLALEEQLHRQEGE
YKEYVYNLEKKSVLDKDRLRKEIIQRVNLVATEFRKMATNQMWETTRRAILENNSVTLQL
NKVSKHGVQLLQENEQLKGTQNKLCQQLEMLENTQEIMARKNIGHKKIILMLTEKCRQQR
KGTEETEQLRLLLSQLEQNFQNVQRDNQTLRSEKDQLEAQLKEKQAEANRLQEELTKEQK
IRANLKTVLIQATSMLQDIVHMQTEAEDGDFDVVFQLQRKELLQQLLVLLSSGVVLKTQP
DMGSHQDKQPQGLSKESQRITQTSKEGAVSLLQQLSTITTYKPGDLGLVPRRPVRIPLKP
QDLRPLSYITRMGICQNTNEIYPSGALKRFRKFTLPRPFLHRK
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctccaaaaaagaagccaaacaaaggaggcaaggagatgcagggcaagaagataggg
ggcaagaaggatgccagtgggaccaagactccagagttggccatggtggaggagctgaag
gaattctaccacaaacagatccaagacctggaggacaggctggcccggtatcagcggaaa
tgggatgaactggctgtgcgggagaagctgttccatcaggagttcgagcagctggccaac
aacaagaaggagattgtggccttcctcaagcgcacgctgaaccagaaggtggatgagatc
acagaccttaatgaccagctgcagagcctggaggtggccaaggatatggagaaggacgcg
ttcgaggcccaactggcccaggtgcgccatgaattccaggaaatcaaggaccagctcacc
acagagaacatcgccctcgggatcaagctgagttccctggaagaattccggctgcagaaa
gaggagctcacggagaagtacttggcactggaggagcagctccataggcaggagggcgag
tacaaggaatacgtgtacaacctggagaagaagtctgtgctggacaaggacaggctgagg
aaagagattatccagcgtgtgaacctggtggccacagagttccgaaagatggccaccaac
cagatgtgggagacgaccaggcgggccatcctagagaacaacagcgtgactctgcagcta
aacaaggtgtccaagcatggtgtgcagctgctgcaggagaatgagcagctcaagggcacc
cagaacaagctgtgccaacagctggagatgctggagaacacccaagagatcatggccaga
aagaacatagggcataagaagattatcctcatgctgaccgagaagtgccgccaacagaga
aagggcacagaggagacggagcaactgcgcctcctgctgtcccaactggagcagaacttc
cagaatgtgcagagggacaaccagaccctgaggagtgagaaagaccagctggaagcgcaa
ctgaaggagaagcaggcagaggcaaatcggctacaggaggagctgaccaaggaacagaaa
attcgggcaaaccttaaaacagtcctgatccaggcgacctccatgctacaggacattgtg
cacatgcaaacagaggcggaggacggcgactttgatgtggtgttccaactgcagcgcaag
gagctgctgcagcaactgctggtattgctcagctcaggggtggttttgaaaacacagccg
gacatgggttcccaccaggacaagcagccccagggcctatccaaagaaagccaacgcatc
acccagacatccaaggaaggggctgtttctctgctgcagcagctctcgaccatcacaacc
tataagccaggggatcttgggctggtgcctcgacgtccggtccgcatcccactcaaaccc
caggatctcaggcccctctcctatatcacccgaatggggatctgccagaacacgaatgag
atctacccatctggagctctcaaaaggttcagaaagtttacccttcctagacctttccta
caccgcaaatag

DBGET integrated database retrieval system