KEGG   Mus musculus (mouse): 227737
Entry
227737            CDS       T01002                                 

Gene name
Niban2, 9130404D14Rik, Fam129, Fam129b, Meg-3
Definition
(RefSeq) niban apoptosis regulator 2
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: PH
Other DBs
NCBI-GeneID: 227737
NCBI-ProteinID: NP_666231
MGI: 2442910
Ensembl: ENSMUSG00000026796
Vega: OTTMUSG00000012546
UniProt: Q8R1F1
Position
2; 2 B
AA seq 749 aa
MGDVLSTHLDDARRQHIAEKTEKILTEFLRFYEDQYGVSLFNSMRHEIEGTGPPQAQLLW
RKVPLDERIIFSGNLFQYQEDNKKWRNRFSLVPHNYGLVLYENKVAYERQIPPRAVINSA
GYKVLTSVDQYLELVGNSLPGTTSKSGSTPILKCPTQFPLILWHPYARHYYFCMMTEAEQ
DKWQAVLQDCVRHCNNGIPENSKVEGPAFTDAIRMYRQSKEQYGTWEMLCGNEVQILSNL
VMEELGPALKAELGPRLKGKPQERQRQWIQISDAVYRLVFEQAKVHFEDVLCKLQRARPA
MEAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSQLAYHPLKMQSCYEKMEPLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRILERVLKKY
DYDSSSVRKRFFREALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVLHNSDPNLHLLAEGTPIDWGEQYGDSGDSG
GGDSGGSPCPSEAATLTEKRRRAKQVMSVVQDEESGLPFEAGVEPPSPASPDSVTELRGL
LAQDLQAESSPPASPLLNGAPVQESSQPVAVPEASPPASPLRHLPPGKAVDLEPPKPSDQ
ETGEQVSSPGSRPPIHTTTEDSAGVQTEF
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgggagacgtactgtccacacacctggatgacgcacggcgccagcacatcgcagagaaa
accgagaagatcctcacagagttccttcgcttctatgaggaccagtatggtgtctccctc
ttcaatagcatgcgccatgagatcgagggcaccgggccaccgcaggcacagctgctctgg
cgcaaggtgcccctggatgaacgcatcatcttctccggaaaccttttccagtaccaggaa
gacaataagaagtggagaaaccgcttcagcctggtgccccataactatgggctggtgcta
tatgagaacaaagtggcctatgagcggcagataccaccccgggccgtcatcaacagcgcg
ggctacaaggttctcacctctgtcgaccagtatctggagctggtcggcaattccctgcca
gggaccacatcgaaatcaggctccacccccatccttaagtgcccaacgcagttccctctc
atcctgtggcatccttacgcccgacactattacttctgcatgatgacagaagcggagcag
gacaagtggcaggcagtgcttcaggattgcgttcgacactgcaacaacgggatcccggag
aactcaaaggtggagggccctgcattcacagacgccatccgcatgtaccgccagtcaaag
gagcagtacggcacctgggaaatgctgtgtggcaacgaggtgcagatcctaagcaacctg
gtgatggaggagctgggcccagcgctgaaggcagagcttggcccacggctgaagggaaag
cctcaggagcggcagcgacagtggatccagatctcggacgctgtgtaccgcctggtattt
gaacaggccaaggtgcactttgaggacgtgctgtgtaagctgcagcgggcccggccggcc
atggaggcagtcatccgcaccgacatggaccagatcatcacctccaaggagcatctggcc
agcaagatccgagccttcatcctccccaaggcggaggtgtgcgtgaggaaccacgtccag
ccctacatcccatccatcttggaggctctgatggtgcccaccagccagggcttcaccgag
gtgcgggatgtcttcttcaaagaggtcacagacatgaatctgaacgtgatcaacgagggt
ggcattgacaagctgggcgagtacatggagaagctatcccagctggcataccaccccctg
aagatgcagagctgctatgagaagatggagccactgcggctcgacgggctgcagcagcga
ttcgacgtgtctagcacttccgtgttcaagcagcgagcccagatccacatgcgagagcaa
atggacaatgctgtgtacaccttcgaaaccctcctgcaccaagagctggggaagggaccc
accaaggaggagctgtgcaaatccatccagcggattctagagcgcgtgctgaagaaatac
gactatgacagcagttctgtgcgcaagagattcttccgagaggcgctgctgcagatcacc
attcccttcctgctcaaaaagctggcccccacctgcaagtcggagctgccacgcttccag
gagctgatctttgaagactttgccaggttcatcctggtggagaacacgtacgaggaggtg
gtgctgcagacggtcatgaaggacatcctgcaggctgtgaaggaggccgcagtgcagcgc
aaacacaacctctaccgtgacagcatggttctgcacaatagtgaccccaatctacacctg
ctggctgagggcacaccaatcgactggggcgaacagtacggtgacagcggtgacagcggc
ggtggtgacagtggtggcagcccctgcccctctgaagcagccaccctcacagaaaagcgc
aggcgtgccaagcaggtgatgtccgtggtccaggacgaggagtcggggctgccctttgag
gctggcgttgaaccgccatcacctgcatccccggacagtgtcaccgagctccgaggcctg
ttggcccaggacctgcaggctgaaagctccccaccagccagccctcttctcaatggggct
ccagtccaagagagctcccaacccgtggcagtcccagaggcctcaccgccagcctcaccc
ctccggcatctcccacctggaaaggctgtggaccttgagccccctaagcccagtgaccaa
gagaccggagagcaggtgtctagccccggtagccgtccccccatccataccaccactgag
gacagtgcgggagtgcagacggagttctaa

DBGET integrated database retrieval system