KEGG   Mus musculus (mouse): 227738Help
Entry
227738            CDS       T01002                                 

Gene name
Lrsam1
Definition
(RefSeq) leucine rich repeat and sterile alpha motif containing 1
  KO
K10641  E3 ubiquitin-protein ligase LRSAM1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    227738 (Lrsam1)
   04121 Ubiquitin system [BR:mmu04121]
    227738 (Lrsam1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     227738 (Lrsam1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    227738 (Lrsam1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    227738 (Lrsam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 zf-C3HC4_3 LRR_4 SAM_1 SAM_2 Prok-RING_4 zf-RING_5 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 227738
NCBI-ProteinID: NP_955006
MGI: 2684789
Ensembl: ENSMUSG00000026792
Vega: OTTMUSG00000012573
UniProt: Q80ZI6
Position
2; 2 B
AA seq 727 aa AA seqDB search
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLVTIKVLDLHENQLTALPDDMGQLTVLQVLNVERNQLTHLP
RSIGNLLQLQTLNVKDNKLKELPDTLGELRSLRTLDISENEIQRLPQMLAHVRTLETLSL
NALAMVYPPPEVCGAGTAAVQQFLCKESGLDYYPPSQYLLPVLEQDGAENTQDSPDGPAS
RFSREEAEWQNRFSDYEKRKEQKMLEKLEFERRLDLGQREHAELLQQSHSHKDEILQTVK
QEQTRLEQDLSERQRCLDAERQQLQEQLKQTEQSIASRIQRLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETENLRQREIAAAMQQMLTESCKSRLIQMAYESQRQSLAQQACSS
MAEMDKRFQQILSWQQMDQNKAISQILQESVMQKAAFEALQVKKDLMHRQIRNQIRLIET
ELLQLTQLELKRKSLDTETLQEMVSEQRWALSNLLQQLLKEKKQREEELHGILAELEAKS
ETKQENYWLIQYQRLLNQKPLSLKLQEEGMERRLVALLVELSAEHYLPLFAHHRISLDML
SRMSPGDLAKVGVSEAGLQHEILRRAQDLLAVPRVQPELKPLENEVLGALEPPTAPRELQ
ESVRPSAPPAELDMPTSECVVCLEREAQMVFLTCGHVCCCQQCCQPLRTCPLCRQEISQR
LRIYHSS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcttctttcggaagcggaaacccagtgaggaggctcgaaaacgcctggagtac
cagatgtgtctggcaaaagaagctggggcagatgacattctcgacatctctaaatgtgag
ctctctgagattccatttggggcttttgcaacgtgcaaagttctacagaaaaaggtgttg
attgtccatacaaaccacctcacctccctgcttcccaagtcctgcagcctcttgagcctt
gtcaccatcaaggttctggatctccatgagaaccagctgacagcccttcctgatgacatg
gggcagctgacagtcctgcaggtattgaatgtggaaagaaatcaactcacgcatctccct
cgctctattgggaacctgctgcagctccagacgctcaatgtaaaagacaacaagctgaag
gagcttcctgacaccctgggggagctgcggagcctgcggacactcgacattagtgagaac
gagattcagagacttccccagatgctggcgcacgtgcggaccctggagacgctgagcctc
aacgccttggcaatggtctaccccccaccagaggtgtgtggcgctggcactgcggccgtg
cagcagttcctctgcaaagagtcaggactggactattacccaccttctcagtacctgctg
ccagtcctggagcaagatggagcagagaacacccaagacagccccgatggacccgcaagc
cgattctccagggaggaggctgaatggcagaatcggttctccgactacgagaagcggaag
gagcagaagatgctggagaagctggagttcgagcggcgcctggaccttgggcagcgggag
cacgctgagctactgcagcagagccacagccacaaggacgagatcctgcagacggtcaag
caggagcagacacggctagagcaggacctgagcgagcgccagcgctgtctggatgcagag
cggcagcagctgcaggagcagctcaagcagacggagcagagcatcgccagccgcattcag
agactcctgcaggacaaccagaggcaaaagaagagttctgagattctgaaatcgctggag
aatgagagaataagaatggagcagttgatgtccatcacccaggaggagacagagaacctc
aggcagcgtgagatcgccgccgccatgcagcagatgctgacggagagctgtaagagccgg
ctcatccagatggcctatgagtctcagaggcagagcctggcgcagcaggcctgttccagc
atggctgaaatggacaagcggttccagcagattctgtcttggcagcagatggatcagaac
aaagccatcagccagatccttcaggagagtgtaatgcagaaggctgccttcgaggctctc
caggtgaagaaggacctgatgcatcggcagatcaggaaccagattaggctaatagaaact
gagttactgcagctgacacagctggagttaaagaggaagtccctggacacagagacgctt
caggagatggtctcagagcagcgctgggcactcagcaacctgctccagcagctcctgaaa
gagaagaagcagcgggaagaggaactccatggcatcctggcggaattagaggccaagagc
gaaacgaagcaggaaaattactggctcatccagtaccaacggcttttaaaccagaagcct
ttgtccttgaaactgcaggaagaaggcatggagcgacggctggtggccctgctggtggag
ctttctgcagagcactacctgcccctcttcgcccaccaccgcatctcactggacatgctg
agccgaatgagccccggagatctggctaaggtgggcgtctcagaagcaggcctgcaacat
gagatcctacggagagcccaggacctgctagctgtgcctagggtccagccagagttgaaa
ccactcgagaatgaggtccttggtgccctcgagccccccacagctccccgggagctccaa
gagtcagtgcgaccgtccgcccccccagctgaactggacatgccgacctcagagtgtgtt
gtgtgcctggaacgtgaagcccagatggtcttcctcacctgtggccacgtctgctgctgt
cagcagtgctgccagcctctgcgcacctgcccactgtgccgccaggagatctcccagcgc
ctccggatctaccacagcagctga

DBGET integrated database retrieval system