KEGG   Mus musculus (house mouse): 22775
Entry
22775             CDS       T01002                                 
Symbol
Zik1
Name
(RefSeq) zinc finger protein interacting with K protein 1
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22775 (Zik1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22775 (Zik1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22775 (Zik1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf_UBZ zf-C2H2_11 Zn-ribbon_8 zinc_ribbon_15 C1_1 Zn_ribbon_SprT zf-H2C2_5
Other DBs
NCBI-GeneID: 22775
NCBI-ProteinID: NP_033603
MGI: 108070
Ensembl: ENSMUSG00000030393
UniProt: Q80YP6
Position
7:complement(10221151..10229308)
AA seq 463 aa
MTAEMDMALMQGCVTFQDVAICFSHEEWRLLDETQRLLYLSVMLQNFALINSQGCGHKTE
DEERRVSTRASKGLRSETTPKTNLCEKCVPILQDILCLPGLPGQKHSTEASSKVDQHQDH
NSTGKPLEKNADRSSYLFYLSAKSFPSWDVEKDLPDILSLLKSQVCPKTKKYRKSTEGRK
ETSHESDKSEECQSLSSQKQTLAHHPKTSNGKKLYECSKCGKTFRGKYSLDQHQRVHTGE
RPWECRDCGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKTHTGARPYE
CSQCGKSFSQKATLVKHKRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECREC
GKSFSQKATLIKHQRVHTGERPYKCSECGKSFSQSSILIQHRRIHTGARPYECSQCGKSF
SQKSGLIQHQVVHTGERPYECDTCGNSFSQCSSLIHHQKCHNA
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgactgcagaaatggatatggccctcatgcagggctgtgtgacctttcaagatgtggcc
atttgcttctcccatgaagaatggagacttcttgatgagactcagaggctcctgtacctc
agtgttatgctgcagaactttgcactcataaactcccagggttgtgggcataaaacagaa
gatgaagagcgaagggtttctacacgagcgtcaaagggtttgagatccgagaccacaccg
aaaactaacctctgtgaaaagtgtgtcccgattctgcaagacattttgtgcctgcctggt
ctacctgggcagaaacatagtacagaggcaagttcaaaagttgatcagcaccaagaccat
aatagtacaggaaaacccttggagaagaatgctgacaggtcttcatacctgttctacctg
tcagcaaagtccttccccagttgggatgttgaaaaagacctcccagatatactgagcctt
ctgaagtctcaggtctgtcccaaaactaagaagtacagaaaaagcactgagggtaggaaa
gaaacaagtcatgaaagtgacaagtcagaagagtgtcagagcctttccagtcaaaagcaa
acacttgctcaccacccaaaaacctccaatggaaagaaactttatgagtgcagcaaatgt
ggaaagaccttccgtggcaaatactcccttgatcaacatcagagagtccacaccggagag
aggccttgggagtgtagagattgtgggaaattctttagccagacctcccacctgaatgat
caccgtagaatacacactggagagaggccttatgagtgcagtgaatgtgggaaattattt
agacagaactccagtcttgttgatcaccagaaaactcatactggagcaagaccatatgag
tgtagccagtgtgggaagtcctttagtcaaaaagctacacttgttaaacacaagagagtt
cacactggagaaaggccttacaagtgtagtgagtgtgggaattcctttagtcaaagtgcc
attcttaaccaacaccggagaattcacactggagtaaagccttatgaatgtagagaatgt
gggaaatcttttagccaaaaagctacccttattaaacaccagcgagttcacactggagaa
aggccttacaagtgtagtgagtgtgggaaatctttcagtcaaagctccatccttattcaa
caccggagaattcatacaggagcaaggccctatgagtgtagccagtgtggaaagtccttt
agccaaaagtccggtctcattcagcatcaggtagttcacactggagaaaggccatatgaa
tgtgacacatgtgggaattcttttagtcagtgctctagcctcattcatcaccaaaaatgt
cataacgcttaa

DBGET integrated database retrieval system