KEGG   Mus musculus (mouse): 227835Help
Entry
227835            CDS       T01002                                 

Gene name
Gtdc1, E330008O22Rik
Definition
(RefSeq) glycosyltransferase-like domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3524 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 227835
NCBI-ProteinID: NP_766250
MGI: 2444269
Ensembl: ENSMUSG00000036890
Vega: OTTMUSG00000012356
UniProt: Q8BW56
Position
2; 2 B
AA seq 445 aa AA seqDB search
MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYR
TLFASSVLNLTELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSCLVAD
VVVFNSSFNMESFLTSIGKFLKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHK
IAHLRRMLSLIGDAAASQSVAPCPQPGQRVSEKSPENCESKSDEHPDLDAEQEALDNPSV
HKSGSLPVSKENLPLDPSTLLCGAEDPQRPLHITWPHRWEHDKDPETFLKILMSLKQLNL
NFHVSVLGETFTDTPDIFSEAKKALGSSVLHWGYLPRKEDYFRVLCMADVVISTAKHEFF
GVAMLEAVYCGCYPLCPKALVYPEIFPAEYLYSTPEQLSKRLKSFCKRPDIIRKHLYKGE
VAPFSWAALHGKFRSLLTTEPREDL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgtcatcatcgaggcattttatggaggctcccatcgacagctggtagagctg
ctccgagaagaattagatgactgcgtgttgtacactcttcctgcaaagaaatggcactgg
agagcacgcacagcagccttatacttctcacagaatattcccagcagtgagcactacagg
accctctttgcaagctcagtactcaacctgactgaactggctgcccttcggcctgatctg
ggaaaactgaaaaagatcttatacttccatgaaaaccagttggtgtatcctgtcaagaaa
tatcaggagagagattttcaatatggatacaaccaaattctctcgtgtttggtggctgat
gttgtggtattcaattccagttttaatatggaatcatttcttacttctattggaaaattc
ctgaagctgattcctgatcacaggcctaaggatctggaaagcattatcagacccaagtgt
caagttatttattttcccatcagatttcctgatgtgagcagattcatgcccaagcacaaa
atagcccacttaaggaggatgctcagccttattggagatgctgctgcatctcagtctgtg
gcgccttgtccccagccagggcagagggtttctgagaagtcaccggagaactgtgaatca
aagtctgatgaacaccctgaccttgatgctgaacaagaagccctggacaacccatcagtc
cataaatcaggctctcttcctgtgagtaaagaaaacctgcctcttgatcccagcaccctt
ctgtgtggagctgaagatccgcaaagaccgctgcacattacatggccgcacaggtgggag
catgacaaagatccagagacgttcttaaagatactaatgagtctaaagcagttaaacttg
aacttccatgtctctgtcctcggagagacttttacagacacaccagatatattttcagaa
gccaaaaaggcactgggctcttcagtcttgcactggggctacttaccccgtaaagaagac
tatttccgcgtactgtgcatggctgacgttgtcatctcaacagccaagcatgaattcttt
ggagtagcaatgttggaagctgtgtactgtggctgctacccactctgtcccaaagccttg
gtctatcctgagatctttccagctgagtatctgtattccacacctgaacagctttcaaaa
cggctcaagagtttctgcaagaggccagatattataagaaaacatctttataagggtgaa
gtggctccattttcttgggcagccctacatggtaaattcaggtctctgctcacaacagaa
cccagggaagatttgtga

DBGET integrated database retrieval system