KEGG   Mus musculus (mouse): 227867Help
Entry
227867            CDS       T01002                                 

Gene name
Epc2, 5830499L14, D2Ertd694e
Definition
(RefSeq) enhancer of polycomb homolog 2
  KO
K11322  enhancer of polycomb-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    227867 (Epc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     227867 (Epc2)
    NuA4 complex
     227867 (Epc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E_Pc_C EPL1 CAF1A
Motif
Other DBs
NCBI-GeneID: 227867
NCBI-ProteinID: NP_766251
MGI: 1278321
Ensembl: ENSMUSG00000069495
Vega: OTTMUSG00000012480
UniProt: Q8C0I4 Q3TNY4
Position
2 C1.1; 2 28.62 cM
AA seq 808 aa AA seqDB search
MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAIS
AQQVFREKKESMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSE
DETLLNRLNRKMEIKPLQFEIMIDRLEKASSNQLVTLQEAKLLLNEDDYLIKAVYDYWVR
KRKNCRGPSLIPQIKQEKRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRE
FSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGGEILNEVKVNRSEKELYASPA
TLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEAGIAPQQPTPETLPVI
NKSDIKQYDFQSSDEDEFPQVLSPASEAEEENDPDGSCAFRRRAGCQYYAPRLDQANNHM
CENSELADLDKLRYKHCLTTLTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPE
MLNGFSSSSQTIDFSSNFSRTNASSKPCENRLSLSEILSNIRSCRLQCFQPRLLNVQDID
SEECTSRKPGQTVSSKRVSAASVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQQLA
QLHQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASAHFAASAVVSAPVPSRSEGSKEQN
TGHNNMNGVVQPSGPSKTLYSTNMALSSSPGISAVQLVRTVGHTTTNHLIPALCTSSPQT
LPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRVPKVTPSSAI
SSIARENHEPERLGLNGLAETTVAMEVT
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactctccttccgagcgcgggcgctggacgccgccaaaccgctgcccatctac
cgcggcaaggacatgcctgatctcaacgactgcgtctccatcaaccgggccgtgccccag
atgcccaccgggatggagaaggaggaggaatcggaacatcacctacagcgagctatttca
gcgcagcaagtatttagagaaaaaaaagagagcatggtcattccagttcctgaggcagag
agcaacgtcaactattacaatcgcttgtacaaaggggagttcaaacagcccaagcagttc
attcatattcagccttttaacctagacaacgagcaaccagattatgatatggattcagaa
gatgagacattattaaatagacttaacagaaaaatggaaattaaacctttgcaatttgaa
attatgattgacagacttgaaaaagccagttctaaccagcttgtaacacttcaagaagca
aaactgctgctaaatgaagatgattatcttattaaagctgtatatgactactgggtgaga
aaacgaaagaactgcagggggccatccctcattccccagattaagcaagagaaaagagat
ggctctaccaacaatgatccttacgttgcctttcggaggagaacagagaaaatgcagact
cggaagaaccgtaagaatgatgaagcttcttatgaaaagatgctgaagctgaggcgggag
ttcagcagagccataacaattttggaaatgattaagagaagagaaaaaaccaaacgggaa
ttattgcacttaacactggaagttgtggaaaaaagatatcatttgggagactatgggggt
gaaatccttaatgaagtgaaagttaatagatcagaaaaagagttatatgccagtccagca
acccttcataatggaaatcatcacaaagttcaagaatgtaaaactaagcaccctcatcat
ttgtctttgaaagaagaggcttctgatgtggttcgtcaaaagaagaagtacccaaagaag
cctaaggcagaggctgggatagcccctcagcagcccactcctgagacattgcctgtgatc
aataagagtgacattaagcaatatgactttcagagctcagacgaagatgaatttccacag
gtgctgtctccagcttcagaggctgaggaggagaatgaccctgacggttcctgtgctttc
agaagacgggcaggatgccagtattacgctccgcgtttggaccaagctaataaccatatg
tgtgaaaattcagagttggcagacttggataagttgaggtataagcattgtcttacgaca
cttacagttccaagaagatgtataggatttgcaaggaggcgaattggcagaggtggcagg
gtcataatggaccgaatatccacagaacatgaccccgtcctgaaacagatagaccctgag
atgctgaacgggttttcaagctcttcccaaactatagacttttcttctaatttctctcgg
accaatgcttccagtaaaccttgtgaaaatagactgtctctttctgaaatattaagcaat
atcagatcatgtcgactacagtgtttccagccaaggctactaaatgtacaggacattgat
agtgaagaatgtacctcaagaaaaccagggcagactgtgagcagtaaaagagtttctgca
gcatccgtagctttattgaacaccagcaagaacggcatatcagtaacagggggcatcaca
gaagagcagtttcagacacatcaacagcagctagttcaaatgcaaaggcagcaacttgcg
cagcttcatcagaaacaacaatcccagcattcctcacagcagacacatccaaaagcacag
ggctcaagcacctctgactgtatgtctaaaacacttgactcagccagcgcccactttgct
gcatctgcagtggtcagtgctcctgttccaagtcgcagtgagggatccaaggaacagaac
actggccacaacaatatgaatggtgttgtccagccttcaggaccctctaaaacattatat
tccaccaatatggctttatcatccagcccagggatttcagctgtacagcttgtaaggaca
gttggccacactactacaaaccacttgatcccagcgttgtgcacaagcagtcctcagaca
cttcccatgaacaattcctgcctgaccaatgcagtgcacctcaataacgtcagtgttgtt
tctcctgtcaatgtgcatatcaatacacggacttcagcaccatcgccaacagccttaaaa
cttgccacagttgctgccagcatggacagagtgccaaaggttactcccagcagtgccatc
agcagcatagccagagagaaccatgaaccagaaagactgggtttaaatggactagcagag
acaacagtagctatggaggtgacataa

DBGET integrated database retrieval system