KEGG   Mus musculus (mouse): 22793
Entry
22793             CDS       T01002                                 

Gene name
Zyx, 9530098H06Rik, R7515, R75157
Definition
(RefSeq) zyxin
  KO
K06273  zyxin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22793 (Zyx)
SSDB
Motif
Pfam: LIM zf_C2H2_13
Other DBs
NCBI-GeneID: 22793
NCBI-ProteinID: NP_001276546
MGI: 103072
Ensembl: ENSMUSG00000029860
Vega: OTTMUSG00000057508
UniProt: Q62523 Q8CBM0
Position
6; 6 B2.1
AA seq 564 aa
MAAPRPPPAISVSVSAPAFYAPQKKFAPVVAPKPKVNPFRPGDSEPPVAAGAQRAQMGRV
GEIPPPPPEDFPLPPPPLIGEGDDSEGALGGAFPPPPPPMIEEPFPPAPLEEDIFPSPPP
PLEEEGGPEAPTQLPPQPREKVCSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVAT
PFVPKPSTKPAPGGTAPLPPWKTPSSSQPPPQPQAKPQVQLHVQPQAKPHVQPQPVSSAN
TQPRGPLSQAPTPAPKFAPVAPKFTPVVSKFSPGAPSGPGPQPNQKMVPPDAPSSVSTGS
PQPPSFTYAQQKEKPLVQEKQHPQPPPAQNQNQVRSPGGPGPLTLKEVEELEQLTQQLMQ
DMEHPQRQSVAVNESCGKCNQPLARAQPAVRALGQLFHITCFTCHQCQQQLQGQQFYSLE
GAPYCEGCYTDTLEKCNTCGQPITDRMLRATGKAYHPQCFTCVVCACPLEGTSFIVDQAN
QPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEA
DDNGCFPLDGHVLCRKCHSARAQT
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggcggccccccgcccgcctcccgcgatctccgtctccgtctcggcccccgcgttttac
gccccgcagaagaagttcgccccggttgtggccccaaagcccaaagtgaatcctttccgg
cctggggacagcgagcctcctgtagcagccggggcccaaagagcgcagatgggtcgggtg
ggcgagatcccaccaccacccccggaagactttcctttgccccctcctccccttattggg
gagggcgacgactcagagggtgccctgggaggtgccttcccacctccacctcccccgatg
atcgaggaaccattcccccctgctcctctggaggaggacatcttcccctcccctccacct
ccactggaggaggagggagggcctgaggcccctacccagctcccaccgcagcccagggag
aaagtgtgcagtattgacctggagattgactctctgtcctcactgctggacgacatgacc
aagaacgatcccttcaaagcccgggtatcatccggatatgtacccccaccagttgccact
ccatttgttcccaagcctagtaccaaacctgcccctgggggcacagcacccttgcctcct
tggaagaccccttctagctcccagccaccacctcagccgcaggccaagcctcaggtccag
ctccatgtccagcctcaggccaagccccatgtccaaccccagcctgtgtcttctgctaat
acacagccccggggtcccctttctcaggcaccaactccagcacctaagtttgctccagtg
gctcctaaatttactcccgtggtttccaagttcagccctggtgctccaagtggacctggg
ccacagcccaatcaaaaaatggtgcctccggatgctccttcttctgtgagcacaggctcc
cctcagccccctagcttcacctatgctcagcagaaggagaagcccctagttcaagagaag
cagcacccacagcctccaccagctcaaaaccaaaaccaggtacgctctcctggaggccca
ggccccttgaccctgaaggaggtagaggagttggagcagctgacccagcagctgatgcag
gacatggaacaccctcagaggcagagcgtggcagtgaatgagtcctgtggcaaatgcaat
cagccactggcccgtgcacagcctgcggttcgtgcactgggacaactgttccacatcacc
tgcttcacttgccatcagtgtcagcagcagctgcagggacagcagttctatagcctggag
ggagcaccatattgtgagggctgctacaccgacactttggagaagtgcaacacctgtggg
cagcccatcactgaccgcatgctgagggccactggcaaagcctaccacccacagtgcttc
acctgtgtggtctgcgcctgtcccctggagggcacctccttcattgtggaccaggccaat
cagccccactgtgtccctgactatcacaagcaatacgctccaaggtgctccgtctgctcg
gagccaatcatgcctgagcctggccgagacgagactgtgcgagtagtggcgctggataag
aactttcatatgaagtgttacaagtgtgaggactgtgggaaacctctgtccattgaggca
gatgacaacggctgtttccctctggatggccacgtcctttgtcggaagtgccactccgct
agagcccagacctga

DBGET integrated database retrieval system