KEGG   Mus musculus (mouse): 227933Help
Entry
227933            CDS       T01002                                 

Gene name
Ccdc148, 5830402J09, Gm38473
Definition
(RefSeq) coiled-coil domain containing 148
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 227933
NCBI-ProteinID: NP_001001178
MGI: 3039583
Ensembl: ENSMUSG00000036641
Vega: OTTMUSG00000012754
UniProt: Q6P5U8
Position
2; 2 C1.1
AA seq 527 aa AA seqDB search
MLIKQHKQVWWQEQERLKGIRCKLESEIRSCLNEESIGSECFCELMNFEKELSEEWCAYL
TAVIDPIQQLRTGLKRWYPTSQSAPCHEGSDATEVLEEVDFVKKQSKAAFERLHQEQWHL
EEDLLDLSVKLLDHSSEEKPNLLSEQPMELVTLDCPYPDLKSSILNEFCNFTERYQEKLE
DFDLQLEDIRSNFQLSAEEHWTYQAVLDQYPGNLLGRRALYLDMLQRYFPHKSRHHLVEH
EKYCDQYHFAREQRRILIDNWSRSRKDFIQKAMLTLLEACAAHEMGSLLAKDRRRQQELC
ADLKAKVSQWRAQQEELSRLEMEISARRREREEEKEKLWKKKELLRREETEIKIRKYWAM
KQQKWQEMEKRDLRRLEELKKLMAEQSVKDRERVKYRQELLEKRLMERKKLALQEVQEEE
ERERRLEALRKQVAVAVQSDPVRMMSETLAWKARTGSESEEEFILQKPLFTLTTYNEQQI
ISDPRLRFELALREAGLHKTQYAKEMLPKIGPQKPPRKDTESTVFKV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcaagcaacacaagcaggtgtggtggcaggaacaggagaggctgaaggggatc
agatgtaaattggagtctgaaataagatcttgtctcaatgaggagagcattgggagtgaa
tgtttttgtgagcttatgaattttgagaaagagctgtcagaagagtggtgtgcgtacctt
acagctgtcattgatcctattcagcagctgagaacgggcctgaagagatggtaccccact
tctcagagtgcaccctgccatgagggctcagacgcaactgaggttctggaagaggttgac
tttgtcaagaaacaatccaaggctgcctttgaaagacttcatcaggagcaatggcactta
gaggaagaccttttggacttgagtgtgaagttactagatcactcttcagaagaaaaacct
aacttgctcagcgaacagcccatggagttagtaacgttggactgcccatacccagatctg
aaatcgtcaatccttaacgagttctgtaactttacagagagatatcaagagaaacttgaa
gattttgatctgcaattagaagacatacgcagtaacttccaactaagtgcagaagagcac
tggacttaccaggctgtcttagaccagtatcccggaaatctccttggcagaagagctctg
tacttggacatgttgcaaagatatttccctcacaagtccaggcatcatttggtagaacac
gagaaatactgtgaccagtatcactttgctagagagcagagaagaatcctgatagacaat
tggagcaggagcaggaaagactttatacagaaagccatgctgactctcctcgaagcctgt
gcagcccatgaaatggggagccttctggccaaggacaggagacggcaacaggaactatgt
gctgacctgaaagccaaggtttctcaatggcgagcccaacaagaagagctatcaagactg
gaaatggaaatttcagccagaagaagagaaagggaagaagagaaagagaaattgtggaaa
aagaaggaattgctacgaagggaggagacagagattaagataagaaaatactgggctatg
aaacagcagaagtggcaagaaatggaaaagagagatctccggcgtctggaagagctgaag
aagttaatggcagaacagtcagtgaaagacagagaaagggttaaatatagacaagaattg
ttggagaagcgtttgatggagagaaaaaaattggcccttcaagaagtccaggaagaagaa
gagagagaaaggcggctggaagccctacgaaagcaggttgctgttgctgtccagtctgac
ccagttagaatgatgtcagagacactggcctggaaagcaaggacaggctctgaaagtgag
gaagaattcatccttcaaaagccgctcttcacactgactacatacaacgagcaacagata
atttccgatcctcgacttcgatttgagttagcacttcgagaagctggactccataaaaca
cagtatgccaaagagatgttaccaaaaattggtcctcagaagcctccaaggaaggacaca
gaatcgaccgtgttcaaggtctag

DBGET integrated database retrieval system