KEGG   Mus musculus (mouse): 228003
Entry
228003            CDS       T01002                                 

Gene name
Klhl41, Gm112, Kbtbd10, SARCOSIN
Definition
(RefSeq) kelch-like 41
  KO
K10473  kelch repeat and BTB domain-containing protein 5/10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    228003 (Klhl41)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     228003 (Klhl41)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_4 Kelch_3 Kelch_2 Kelch_5 DUF3342
Other DBs
NCBI-GeneID: 228003
NCBI-ProteinID: NP_001074556
MGI: 2683854
Ensembl: ENSMUSG00000075307
Vega: OTTMUSG00000013007
UniProt: A2AUC9
Position
2; 2 C2
AA seq 606 aa
MDSQRELAEELRLYQSTLLQDGLKDLLEEKKFIDCTLKAGDKSFPCHRLILSACSPYFRE
YFLSEIEEEKKKEVALDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALSSRFQIPSVFT
VCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELI
SVISNDSLNVEKEEVVFEAVMKWVRTDKENRAKNLSEVFDCIRFRLMAEKYFKDHVEKDD
IIKSNPEVQKKIKVLKDAFAGKLPEPSKNAEKAGAGEVNGDVGDEDLLPGYLNDIPRHGM
FVKDLILLVNDTAAVAYDPMENECYLTALAEQIPRNHSSLVTQQNQVYVVGGLYVDEENK
DQPLQSYFFQLDNVTSEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY
DPVAAKWSEVKNLPIKVYGHNVISHNGMIYCLGGKTDDKKCTNRVFIYNPKKGDWKDLAP
MKTPRSMFGVAIHKGKIVIAGGVTEDGLSASVEAFDLKTNKWEVMTEFPQERSSISLVSL
AGALYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNL
FKLSKL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggattcccagcgggagcttgcagaggaactccggctttaccaatccacccttcttcag
gatggtctaaaagatctcctggaagagaaaaagttcatcgattgcaccctaaaagcaggt
gacaaaagttttccttgccacagactgatactatcggcttgtagcccttacttccgtgag
tattttttatctgaaattgaggaggagaaaaaaaaggaggtagccctagacaacgtggat
cctgctatacttgatttaatcatcaaatatctgtactctgccagtatcgatctcaatgat
gggaatgtgcaagacatcttcgccctgtccagccgcttccagattccgtcggtgttcacc
gtctgtgtgtcttaccttcagaaaagactggctcccggtaactgtctggccatcctaaga
ttggggctgcttctcgactgcccgagacttgccatttctgcccgggagtttgtgtctgat
cgctttgtgcagatttgtaaggaagaagatttcatgcaactgtccccacaagaactgatc
tccgtcatttcaaacgacagcctcaacgtagaaaaggaggaagtagtatttgaggccgtg
atgaaatgggtgcggacagacaaagaaaacagggcaaaaaatcttagtgaggtgtttgac
tgtattcgttttcgccttatggcagagaaatatttcaaagatcatgtcgagaaagatgac
ataattaaaagcaacccagaagtccagaaaaaaatcaaagttctaaaagacgcttttgca
ggcaaacttccggaacccagcaaaaatgcagagaaggcaggggcgggcgaggtgaacggc
gatgttggtgatgaagacttacttcccggttacctgaacgatatccccaggcatggaatg
tttgttaaagatctcatcctcttggtcaatgacacggctgcagtagcgtatgaccccatg
gaaaatgagtgctaccttactgccctggcagagcagatccccagaaaccattccagtctt
gttacccaacagaatcaggtctacgtggtcgggggactgtatgtggacgaagaaaataag
gatcaacccctgcaatcgtactttttccagcttgataacgtaacatctgagtgggtcgga
cttccgcctctcccatcagccaggtgtctctttggcctgggagaagtagatgacaaaatc
tatgtggtggccggcaaagaccttcaaacagaggcctcactggattccgtgctatgctac
gatcctgtggctgcaaagtggagtgaagtgaaaaatcttcctattaaagtttatggccat
aatgtgatttcacacaatgggatgatatactgtctaggcggaaagacagatgacaaaaag
tgtacaaatagggtatttatctacaaccccaagaaaggagactggaaagatctggctccg
atgaaaacccctcgttccatgtttggcgtggcaatccataaaggcaagattgtgatcgca
ggaggtgtcactgaagatggtctttcagcttcagttgaagcctttgacctcaaaaccaat
aagtgggaagtgatgacggaatttccccaagaaagaagttctatcagcctggtgagcctg
gcgggagccctgtacgccatcggtggctttgcgatgatccagctggaatctaaagagttt
gcacccactgaagtcaatgacatatggaagtatgaagatgataaaaaagaatgggctggg
atgctgaaggaaatccgttacgcttcgggagctagttgcctagcaacgcgcttaaatctg
tttaaactgtctaaactataa

DBGET integrated database retrieval system