KEGG   Mus musculus (house mouse): 228026
Entry
228026            CDS       T01002                                 
Symbol
Pdk1, B830012B01, D530020C15Rik
Name
(RefSeq) pyruvate dehydrogenase kinase, isoenzyme 1
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    228026 (Pdk1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    228026 (Pdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    228026 (Pdk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     228026 (Pdk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   228026 (Pdk1)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 228026
NCBI-ProteinID: NP_766253
MGI: 1926119
Ensembl: ENSMUSG00000006494
UniProt: Q8BFP9
Position
2:71703398..71734202
AA seq 434 aa
MRLARLLRGGTSVRPLCAVPCASRSLASASASGSGPASELGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDL
YYVNSPELELEELNAKSPGQTIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQ
VHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPIS
RLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYKANHEADDWCV
PSREPKDMTTFRSS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaggctggcaaggctgctgcggggcggcacgagcgtcaggccgctctgcgccgtcccc
tgcgccagccgtagcctggcctcggcctcggcctcgggttccgggccggcgtcggagctt
ggcgttccgggccaggtggacttctatgcgcgcttctcgccgtcgccactctccatgaag
cagttcctggacttcgggtcagtgaatgcttgtgaaaagacctcgtttatgtttctgcga
caagagttgcctgttagattggcaaatataatgaaagaaatcagcctcctccccgacaat
cttctcaggaccccatccgtacagctggtgcaaagttggtatatccaaagccttcaggag
ttgcttgattttaaagacaaaagtgctgaagatgctaaaactatttatgaattcacagac
acagtgataaggatcagaaaccggcacaatgatgtcattcccaccatggcccagggtgtg
actgaatacaaggagagcttcggggtggatcctgtcaccagccaaaatgttcagtacttt
ttggatcgattctacatgagtcgcatctcaattagaatgctactcaaccagcactcctta
ttgttcggtggaaaaggaagtccatctcatcgaaagcacattggaagcataaatccaaac
tgcgacgtggtggaggtcattaaagatggctatgagaacgctaggcggctttgtgatttg
tattatgttaactctcctgaacttgaacttgaagaactaaatgcgaaatcaccaggacag
acaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactgttcaag
aatgccatgagagcgaccatggagcaccacgcggacaaaggcgtttatcccccgattcag
gttcacgtcacgctgggcgaggaggatctgactgtgaagatgagtgaccggggaggcggt
gttccactgaggaagatcgacagactcttcaactacatgtactcaaccgcaccccggcct
cgtgttgaaacgtcccgtgctgtgcccctggctgggtttggttacggattgcccatatca
cgcctctatgcacagtacttccagggagacctaaagctgtattccttagagggctacggg
acagatgcggttatctacattaaggctctgtcgacagaatccgtcgagagactccctgtg
tacaataaagccgcctggaagcattacaaagccaaccacgaggctgacgactggtgtgtg
cccagccgagagccgaaagacatgaccacattccgaagctcttaa

DBGET integrated database retrieval system