KEGG   Mus musculus (mouse): 228061Help
Entry
228061            CDS       T01002                                 

Gene name
Agps, 5832437L22, 9930035G10Rik, AW123847, Adaps, Adas, Adhaps, Adps, Aldhpsy, bs2
Definition
(RefSeq) alkylglycerone phosphate synthase
  KO
K00803  alkyldihydroxyacetonephosphate synthase [EC:2.5.1.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    228061 (Agps)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    228061 (Agps)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.26  alkylglycerone-phosphate synthase
     228061 (Agps)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 BBE
Motif
Other DBs
NCBI-GeneID: 228061
NCBI-ProteinID: NP_766254
MGI: 2443065
Ensembl: ENSMUSG00000042410
Vega: OTTMUSG00000013293
UniProt: Q8C0I1 A2AL50
Position
2; 2 C3
AA seq 671 aa AA seqDB search
MVARGAALSDLSPEPSGLGRRHKAEAMAEAAAGEAGASERDPDAGRARRRLRVLSGHLLG
RPQEAPSTNECKARRAASAAGASPAATPAAPESGTIPKKRQEVMKWNGWGYNDSKFLLNK
KGQVELTGKRYPLSGLVLPTLRDWIQNTLGVSLEHKTTSKTSINPSEAPPSIVNEDFLQE
LKEARISYSQEADDRVFRAHGHCLHEIFLLREGMFERIPDIVVWPTCHDDVVKIVNLACK
YNLCIIPIGGGTSVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQDL
ERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKMVTPRGVIEK
SSQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRPTPEYQKYGSVAFPNFEQGVACLRE
IAKQRCAPASIRLMDNQQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQISVAT
LLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLGLEYYVIGES
FETSAPWDRVIDLCRNVKERIRRECKERGVQFAPLSTCRVTQTYDAGACIYFYFAFNYRG
ISDPLTVFEHTEAAAREEILANGGSLSHHHGVGKIRKQWLKESISDVGFGMLKSVKEYVD
PSNIFGNRNLL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgcggggcgccgctctgagtgacctttcacccgagcccagcggcctcgggcgg
cggcacaaggcggaagccatggcggaggcggcggcgggcgaggcgggcgcgagcgagcgg
gacccagacgcgggccgcgcgcgccggcggctgcgggttctgtcgggccatctgctgggc
cggccccaggaggctccgagtaccaatgagtgcaaagcgcggagagccgcgtcggcggcc
ggggcgtcgcccgccgctactcctgccgcaccagagtcgggcaccatccccaagaagcgg
caagaagttatgaaatggaatggatggggctacaatgattccaagttcttattgaataag
aagggccaggttgagctgactgggaaaaggtacccacttagtggcttggttttaccaact
ttgagagactggatccaaaacacccttggagtaagtctggagcataaaactacctctaaa
acatccataaatcctagtgaagcacctccttctattgtgaatgaagatttccttcaggaa
cttaaagaagctcggatttcctactcacaggaagcagatgatcgtgtgtttagagctcac
ggtcattgtcttcacgagatatttttgctcagagaagggatgtttgagcggattcctgat
atagttgtatggccaacatgtcatgatgatgtagttaagattgtgaatctagcttgcaaa
tataacctttgtatcataccaattggtggaggaacaagtgtgtcctatggcttgatgtgt
cctgcagacgagacaagaacaataatttctttggacacttcacaaatgaaccggattctc
tgggttgatgagaacaatctgacagctcacgtagaggctgggataacaggacaagatttg
gaaagacagcttaaagaaagtggttattgtacaggtcatgaaccggactccctggaattc
agcaccgtgggaggatggatatctactcgagcgtcaggcatgaagaaaaatatctatggc
aatattgaggacctggtggttcatatgaaaatggtaacacctagaggtgtaatagagaaa
agctcccaaggacctcgtatgtcaacgggccctgatatccatcacttcattatgggatct
gaaggaactcttggtgtaataacagaagctacaataaagatcagaccaacccctgagtac
cagaagtacggttcggtggctttccctaactttgaacaaggtgtagcctgtttaagagaa
attgcaaagcagagatgtgctcctgcatctatccgcctcatggacaaccagcagttccag
tttggtcatgctcttaaacctcaggtctcttctatttttacatcatttttggatggatta
aaaaagttttatattacaaagtttaaaggatttgatccaaatcaaataagtgtagccaca
ttactgttcgagggagaccgtgagaaggttcttcagcacgaaaaacaagtgtatgacatc
gcagcaaaatttggtggtctggctgctggagaagataacggtcagaggggttatttgctg
acttatgtcattgcatatattcgtgatttgggtttggaatactatgtaataggagaatct
tttgagacttctgctccttgggacagggttatagatctgtgtagaaatgtaaaggagagg
ataagaagggaatgcaaagaaaggggagttcagttcgcacctctttctacgtgcagggtg
acacagacttatgatgcaggtgcatgtatctacttctattttgcctttaactacagggga
attagtgacccactgaccgtgtttgaacacactgaggcagctgctagagaggaaatcctt
gccaatggagggagcctgtcacatcaccatggagtgggcaagatacgaaagcagtggcta
aaggagagcatctctgatgtcggctttggaatgctaaagtcggtcaaggagtatgtggac
ccaagtaacatctttggaaacagaaaccttttataa

DBGET integrated database retrieval system