KEGG   Mus musculus (mouse): 228355Help
Entry
228355            CDS       T01002                                 

Gene name
Madd, 9630059K23Rik, IG20
Definition
(RefSeq) MAP-kinase activating death domain
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DENN uDENN
Motif
Other DBs
NCBI-GeneID: 228355
NCBI-ProteinID: NP_001171190
MGI: 2444672
Ensembl: ENSMUSG00000040687
Vega: OTTMUSG00000014395
UniProt: Q80U28 A2AGR0
Position
2; 2 E1
AA seq 1577 aa AA seqDB search
MVQKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHPEFPLPPDVVFFCQPEGC
LSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRMPKEKVEGGAGPRGKEG
AHTSGASEEAAAGSSESGSTLQPPSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLCVLS
HYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSALL
QDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQELQQALTFALPDPSRFTLVDFPLHLPL
ELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCMA
SAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEPES
LELKKHLKQALASMSLNTQPILNLEKFHEGQEIPLLLGRPSNDLQSTPSTEFNPLIYGND
VDSVDVATRVAMVRFFNSANVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAEK
LARTQAVEYFGEWILNPSNYAFQRIHNNTFDPALIGDKPKWYAHQLQPIHYRVYDGNSQL
AEALSVPPERDSDSDPTEDSGSDSQDYDDSSSSYSSLGDFVSEMMKCDINGDTPNVDPLT
HAALGDASEVEIDELQPQKEGEEPGPDSENSQENPPLRSSSSTTASSSPSTVVHSAHSEA
ADSTEMGDKATAGISKPLPPVPPSICKSTVDRRQTETGEGSVCQRTYDNPYFEPQYGFPP
EEDEEEQGESYTPRFSQHVSGSRAQKLLRPNSLKLASDSDAESDSRASSPNSTVSNNSTE
GFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKTTPFPSLKVFGLNTLMEIVTEAGPG
SGEGNRRALVDQKSSVIKHSPTVKREPSSPQGRSSNSSENQQFLKEVVHSVLDGQGVGWL
NMKKVRRLLESEQLRVFVLSKLNRAVQSEDDARQDVIQDVEISRKVYKGMLDLLKCTVLS
LEQSYAHAGLGGMASIFGLLEIAQTHYYSKEPDKRKRSPTENVNTPVGKDPGLAGRGDPK
AMAQLRVPQLGPRAPSATGKGPKELDTRSLKEENFVASVELWNKHQEVKKQKALEKQRPE
GIKPVFDLGETEEKKSQMSADSGVSLTSASQRTDQDSVIGVSPAVMIRSSSQDSEVSTVS
NSSGETLGADSDLSSNAGDGPGGEGSAHLASSRATLSDSEIETNSATSAIFGKAHSLKPK
EKPAGSPIRSSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAMETFSLSKERSTLWDQMQFW
EDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLL
MKVNKNDIRKKVRRLMGKSHIGLVYSQQVNEVLDQLNSLNGRDLSIRSSGSRHMKKQTFV
VHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSE
TQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDMKTGEGGLLQVTLE
GINLKFMHNQFLKLKKW
NT seq 4734 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaagaagttctgccctcggttacttgactatctcgtgatcgtaggggcgagg
cacccaagcagtgacagtgtggctcagactcctgagctgctgcggaggtacccactagag
gatcacccagagttccccctgcccccagatgtggtgttcttctgccagccagaaggatgt
ctgagtgtgcggcagcggcggatgagccttcgggacgatacctcttttgtcttcacccta
accgataaggacaccggagtcacccgctatggcatctgtgtcaacttctaccgttccttc
caaaagcgaatgccaaaggaaaaggtggaaggcggagcaggaccccgtgggaaggaaggc
gctcacacctctggtgcctcagaagaggctgccgctgggagctcagagagtggctcaacc
ttgcagccgcctagtgctgactccactcctgacgtaaaccagtctcctcggggcaaacgt
agggcaaaagcgggcagccgctcccgcaacagtaccctgacatccctgtgtgtgcttagc
cactaccctttcttctctaccttcagagagtgtctgtatactctcaaacgtttggtagac
tgctgtagtgaacggctgctaggcaagaaactgggcatccctcgaggtgtacaaagggac
accatgtggcgaatctttactggatcactgctagtggaggagaagtccagtgcccttctg
caagaccttcgagagattgaggcctggatctatcggttgctacgttccccagtgcctgtc
tctgggcagaagcgagtggacattgaggtcctgccccaggaactccagcaggccctgaca
tttgctcttccagatccatctcgattcaccctagtagatttccctcttcaccttcccttg
gaacttctgggtgtagatgcttgtcttcaggtgctaacctgcatcctgttggagcacaag
gtggtgctgcagtctcgagactacaatgcactctccatgtctgtgatggcgttcgtggca
atgatctaccccctggagtacatgttcccggtcatcccgctgcttcccacctgcatggcc
tcggcagagcagctactcttggctccaaccccatacatcattggagttcctgccagcttc
ttcctctacaagctagatttcaaaatgcccgatgacgtgtggctagtggatctggacagc
aatagggtgattgcccccaccaatgcagaagtgctacccatcctgccagaaccagaatca
ttagagctgaaaaaacacttaaagcaggccttagccagcatgagtctcaacacccagccc
attcttaacctggagaaattccacgagggccaggagatcccgcttctcttgggaaggcca
tctaatgaccttcagtccacaccttccactgaattcaacccgctcatttatggcaatgat
gtagattcagtcgacgttgcaacgagagtggccatggtacgtttcttcaactctgctaac
gtgctgcagggctttcagatgcacacacgtaccctgcgactcttcccccggcctgtggta
gctttccaagctggctcctttctggcctcacgtccccggcagactccctttgctgagaaa
ctggccaggacccaagctgtggagtattttggagaatggatcctgaacccttctaactat
gccttccagcggattcacaacaatacgtttgatccggcccttattggtgacaagccaaag
tggtacgctcaccagctgcagcccatccattatcgagtctatgatggcaactctcagctg
gccgaggccctgagtgtgcccccggagcgcgattctgactccgacccgacggaggacagt
ggcagtgatagtcaggattatgatgactcaagctcttcttactcctcccttggggacttt
gtcagtgaaatgatgaaatgtgacatcaatggagacactcccaatgtggatcctctgacc
catgcagccctgggagatgccagtgaagtggagattgacgagctgcagccccagaaggag
ggagaggaacccggcccagacagtgagaactctcaggaaaaccctccgctgcgctccagc
tccagcaccacggccagcagcagccccagcaccgttgtccacagtgcccactctgaagct
gctgactctacagagatgggagataaggccacagcaggcatctccaagcccctccctccc
gtgcctcccagcatttgcaaatctactgtggacaggagacagacagagactggagagggg
tcagtgtgccagcgaacctatgacaatccatacttcgagccccagtatggctttcccccc
gaggaagatgaggaggagcagggggagagctacactccccggttcagccagcatgtcagt
ggcagtcgggctcaaaagctgctgcggcccaacagcttgaagctggcaagtgactcagac
gcagagtcagactcgagagcaagctctcccaactccactgtctctaacaacagcaccgag
ggcttcgggggcatcatgtcttttgctagcagcctgtatcggaaccatagtacaagcttc
agtctttcaaacctcacactgcccaccaaaggtgcccgcgagaagacgacaccattcccc
agcctgaaagtatttgggctaaatactctaatggagattgttactgaagccggccctggg
agtggtgaaggaaataggagggccttagtggaccagaagtcatctgtcattaaacacagc
ccaaccgtgaaaagagaaccttcatccccacagggccggtcgagcaactctagcgagaac
cagcagttcctgaaggaagtagtccatagtgtgctggacggccagggagtgggctggctc
aatatgaagaaggtacgccggctcctggagagtgagcagcttagagtctttgtactgagc
aagctgaatcgcgcagtgcagtcagaggatgacgcccggcaggatgtcatccaagacgtg
gagatcagccggaaggtgtacaaggggatgctagacctcctcaagtgcacagtcctcagc
ctcgagcagtcctatgcccacgcaggtctgggtggtatggccagcatctttgggcttttg
gagattgcccagacccactactatagtaaagaaccagacaaacggaagagaagtccgaca
gagaatgtaaataccccagttggcaaggatcctggtctggctgggcggggggacccaaag
gcaatggcccagctaagggtccctcaactgggccctcgggcaccaagtgctacaggaaag
ggtcctaaagaactggataccagaagtttaaaggaagagaattttgtagcatctgttgaa
ttgtggaacaagcaccaggaagtgaaaaagcaaaaggctttggaaaaacagaggccagag
ggcatcaagcctgtctttgacctgggtgagacagaggagaaaaagtcccagatgagcgca
gacagtggtgtgagcctgacatctgcctcccagaggactgatcaagactctgtcatcggt
gtgagtccagctgttatgatccgaagctcaagtcaggattctgaagttagcaccgtgagt
aatagttccggagagacccttggagctgacagtgacctgagcagcaatgcaggtgacggg
ccaggaggcgaaggcagcgcccacctggcaagttcccgggccactctgtccgacagtgaa
atcgaaaccaattctgctacaagcgccatctttggtaaagcccatagcttgaagccaaag
gagaagccggctggtagtccgattcgctcttccgaagacgtaagccagcgagtctatctc
tatgagggactgctaggaagggacaaaggatccatgtgggaccagctagaggatgccgct
atggagaccttttctctgagcaaagaacgttctaccttatgggaccaaatgcagttctgg
gaagatgcattcttagatgctgtaatgttggaaagagaaggaatgggtatggaccagggt
cctcaggaaatgatcgacaggtacctctccctaggggaacacgaccggaagcgcctggag
gatgatgaagaccgcttgctggccacacttttacacaacctcatatcctatatgctgctg
atgaaggtgaacaagaatgacatcaggaagaaagtacggcgcctaatgggaaagtcccac
attgggctggtgtacagccagcaagtcaatgaggtgctcgatcagctgaacagcctgaat
ggacgtgatctctccatccggtccagcggcagccggcacatgaagaagcagacttttgtt
gtgcatgcagggacggacacaaatggagacatctttttcatggaagtgtgtgatgactgc
gtggtgttgcgtagtaacattgggacggtgtacgagcgctggtggtatgagaagctcatc
aatatgacctactgtcccaagaccaaggtcctgtgcttatggcggagaaatggctctgag
acccagctcaacaagttctataccaagaagtgtcgagagctgtactactgtgtgaaggac
agcatggaacgtgctgctgcccgacagcaaagcatcaaacctgggcctgagctaggcggt
gagttccctgtgcaggacatgaagactggagagggtggcttgcttcaagtcaccctggaa
gggatcaatctcaagttcatgcacaaccagttcctgaaattaaagaagtggtga

DBGET integrated database retrieval system