KEGG   Mus musculus (mouse): 228359
Entry
228359            CDS       T01002                                 

Gene name
Arhgap1, B230365D05Rik, C76222, Cdc42G, Cdc42GAP, p50r, p50rhoGAP
Definition
(RefSeq) Rho GTPase activating protein 1
  KO
K18470  Rho GTPase-activating protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228359 (Arhgap1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    228359 (Arhgap1)
SSDB
Motif
Pfam: RhoGAP CRAL_TRIO_2 CRAL_TRIO
Other DBs
NCBI-GeneID: 228359
NCBI-ProteinID: NP_666236
MGI: 2445003
Ensembl: ENSMUSG00000027247
Vega: OTTMUSG00000014300
UniProt: Q5FWK3
Position
2; 2 E1
AA seq 439 aa
MDPLSELQDDLTLDDTSQALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPEPVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISF
KFGRKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKSPGQDPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEVTQQVLQTL
PEENYQVLHFLTAFLVQISAHCDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHQGELFPSTDAQGV
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggaccctctctcagagctgcaagatgacctgacgctggatgacaccagccaagctctg
aaccagttgaagctggcctccattgatgagaagaactggccttctgatgaaatgccagac
ttccccaagtcagatgactccaaaagcagctctccagaacctgtgacacacctgaagtgg
gatgacccttactatgacattgcccggcaccagattgtggaagtagccggtgatgataag
tatgggcggaagatcattgtattcagtgcttgccggatgccccccagccaccagctggac
cacagcaagctcttggggtatttgaaacacacattggaccagtatgtggagagtgactac
acactcctgtacctgcaccatggcctgaccagtgacaacaagccctccctcagctggcta
cgggatgcctaccgagagtttgaccgcaagtacaagaagaacatcaaggctctgtacatc
gtgcacccaaccatgttcatcaaaactctgcttatcctctttaagcctctcatcagtttc
aagtttggacggaagatcttctacgtgaattacctgagtgagctgagcgagcacgtgaag
ctggagcagttggggatccctcgccaagtgctcaagtatgatgacttcctcaaatccaca
cagaaaagccctgcaacagctcccaagcccatgccaccacggccccccctgcccaatcag
cagtttggggtctccttacagcacctccaggagaaaagcccaggccaggaccccattccc
attgtcctcagggagaccgtcgcctacttgcaggctcacgctctcaccactgagggcatc
ttccggaggtctgccaacacccaggttgtccgggaagtgcagcagaaatacaatatgggg
ctgccggtggactttgaccagtacaacgagctgcacttgcccgctgtcatcctcaagaca
ttccttcgggagcttcctgaacccttgctaacctttgacctgtacccccatgttgtgggc
ttcctcaatattgatgaaagccagagagtggaagtgacacagcaggttctccaaactctg
ccagaggagaactaccaggtgcttcatttcctgactgccttcctggtgcagatatctgcc
cactgtgaccagaacaagatgaccaacactaacttggctgtagtcttcggccctaacctg
ctctgggctaaagatgctgccatcaccctcaaggctatcaatcccatcaacaccttcact
aagttcctcctggatcatcaaggggaattgttccccagcacagatgcccagggggtctga

DBGET integrated database retrieval system