KEGG   Mus musculus (mouse): 228361
Entry
228361            CDS       T01002                                 

Gene name
Ambra1, 2310079H06Rik, A130023A14, AA474864, AV021921, D030051N19Rik, mKIAA1736
Definition
(RefSeq) autophagy/beclin 1 regulator 1
  KO
K17985  activating molecule in BECN1-regulated autophagy protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    228361 (Ambra1)
   04137 Mitophagy - animal
    228361 (Ambra1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    228361 (Ambra1)
   05014 Amyotrophic lateral sclerosis
    228361 (Ambra1)
   05016 Huntington disease
    228361 (Ambra1)
   05017 Spinocerebellar ataxia
    228361 (Ambra1)
   05022 Pathways of neurodegeneration - multiple diseases
    228361 (Ambra1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228361 (Ambra1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    228361 (Ambra1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    228361 (Ambra1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    228361 (Ambra1)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A Acyl_CoA_thio
Other DBs
NCBI-GeneID: 228361
NCBI-ProteinID: NP_766257
MGI: 2443564
Ensembl: ENSMUSG00000040506
Vega: OTTMUSG00000014330
UniProt: A2AH22
Position
2; 2 E1
AA seq 1300 aa
MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTV
ECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQ
QDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEW
TRTVLTLNSRSEVESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLAT
ESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIE
SERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSS
WHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASSQEERTVGVAFNQETGHWER
IYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPA
RLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDF
EDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVL
AGAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISA
DGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVG
LASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPE
PGLGLAYGTNKGDLVICRPEALNSGIEYYWDQLSETVFTVHSSSRSSERPGTSRATWRTD
RDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEGEGSE
YGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESG
AARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQPALSSSSPVPIPVP
LASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPSGEPQNR
NT seq 3903 nt   +upstreamnt  +downstreamnt
atgaaagttgtcccagagaagaatgctgtacgaatcctctggggccgagaacggggcact
cgtgccatgggtgcccagcggcttctgcaggagctggtggaggataagactcgatggatg
aaatgggagggcaagagagtagaactgcctgatagtccacgctcgaccttcttactggcc
ttcagcccagacaggactctcttggcatccacacatgtgaaccataacatctatattaca
gaggttaagactggcaagtgtgttcactctctgatcggacaccgccgtactccatggtgt
gtcacttttcaccccaccatctcaggccttattgcttctggttgcctagatggggaagtt
aggatttgggatttacatgggggcagtgaaagctggttcacagacagcaacaatgccata
gcctccttggctttccaccctacggctcagcttctactaattgccactgcaaatgagatc
catttctgggattggagtcgtcgggagccctttgctgtggtgaaaacagccagtgagatg
gagcgtgtccgcctggtgagatttgatccacttggacactacttacttacagctattgtt
aacccttctaatcagcagggtgatgacgaaccagaaatccctatagatggaacagagtta
tctcattaccgtcaacgtgccctcctgcaatcacagccagttcgccggacacctctcctc
cacaatttcctgcacatgctgtcctcccgttcctctggcatccaggtgggagagcaaagc
acagtacaagattctgctaccccctcacccccaccgcctccccctcagccctccacggag
cgtcccaggacttccgcttacatcagactccgacagcgggtcagttaccccaccacagtt
gagtgctgccagcaccctgggatcctgtgcctttgcagccgctgtgctggcactcgagtt
ccttccctcttgccacaccaggacagtgtcccccctgcttctgccagagctactacccct
tccttttcttttgtacagaccgagcccttccatcccccggagcaggcttcatcaacgcag
caggaccagggcctcctgaaccggccgtctgccttcagtacagtccagagcagcactgcg
ggcaacacgctccgcaacctcagtctgggtcctacccggcgctctttggggggccctttg
tctagccacccttctaggtatcacagagaactagcccctgggctgacaggttctgagtgg
acccggacagtactcactctgaactctcgttctgaggtagaatctatgcccccaccgagg
accagtgcctcctcagtgagtttgctttctgtactgagacagcaggaaggtggctctcag
gcatctgtgtatacttcagccacagaagggaggggttttccatcatcagggttggcaact
gagtcagatggagggaatggttccagccaaaacaactcaggcagcattcgccatgagctt
caatgtgacctgagacgcttctttttggagtatgacaggctgcaggagctggatcagagc
ctgagtggggaaactccccagacccaacaggcccaggaaatgctcaacaataatattgaa
tctgagagaccaggtccttcccacctgcctaccccacacagcagtgagaacaactccaac
ctgtctcggggccaccttaatcgatgccgtgcttgccataatcttctaaccttcaacaat
gatacccttcgttgggaaagaaccacacctaactactcatctggtgaggctagctcttcc
tggcacgtctccactacctttgagggcatgccaccaagtggcaaccagctaccacctctt
gagcggactgagggccaaatgcctagctccagcaggctggagttgagcagctctgctagt
tcacaagaggagaggactgtgggggtggcctttaaccaggagacaggccactgggaacgc
atttatacccagtccagcagatctggaactgtatcacaggaggccttacatcaagatatg
cctgaagaaagctctgaggaagactccctcaggaggaggctgctggagtcttccctcatt
tcattatcccgttatgatggagcaggatccagagagcacccaatttacccagacccagcg
agattatctcctgctgcatactacgcccagaggatgatccagtatctctcaaggagagac
agtattcgccagcgctccatgcgctaccaacagaatcggcttcgttcttccacctcctct
tcttcctcagacaaccagggtccatcagtagagggaaccgacttggaatttgaggacttt
gaggacaatggtgacagatctaggcaccgagctccccgaaatgcccgaatgtctgcacct
tcacttggacgatttgttccaaggcgttttttgctgcctgagtacttgccttatgctggg
atttttcatgaacgtggacagcctggcttggctactcattcttctgttaacagggtcctg
gcaggggcagtaattggagatggacagtctgctgtggccagtaacattgccaatactacc
tacaggctccagtggtgggacttcactaagtttgaccttccagaaatcagtaatgcctct
gtgaatgtcctggtacagaattgcaagatctacaatgatgccagctgtgacatttctgca
gatggtcagctcctggcagccttcatcccgagcagccagaggggctttcctgatgaaggc
atcctggcagtgtattccctggccccccataacttgggggaaatgctctacaccaagcga
tttggtcccaatgccatttctgtaagcctgtccccgatgggccgatacgttatggtgggc
ttggcctcacgaaggatcctactgcacccctccacagagcacatggtagcccaggtcttc
aggctgcaacaggcccatggtggtgagacttccatgaggagagttttcaatgtcctttac
cccatgcctgcagaccaacggagacacgtcagcatcaactctgcccgttggctacccgag
ccagggcttggtttggcctatggcaccaacaaaggagacttggtgatctgccgaccagag
gccttaaactctggcatcgagtactactgggaccagctaagtgaaacagtcttcactgtc
cactcaagtagcaggagcagcgagcggcctggaaccagcagagccacgtggcggacagac
agagacatgggtttgatgaatgcaattgggctgcagcctcggaacccaaccacctctgtg
acatctcagggcacccagactctggccctccagttgcagaacgctgaaacacagactgag
agggaggaagaggaaccaggggcagcatcttcaggtcctggtgaaggcgagggctcagaa
tatggtggcagtggggaagatgccctcagcaggatccagaggctgatggccgagggtggc
atgacagctgtggtacaacgggaacagagcaccaccatggcctccatgggtggctttggc
aacaacatcatcgttagccaccgcattcaccgcagctcccagacaggcacagagtcaggg
gctgctcgtacctcctcaccccagccctccacctctcgaggactgccatcagaacctggg
caactggcagagcgagcgctaagcccccggacagcctcctgggaccagcctagtacctct
gggagggaactaccccagccagccctgtcctcttcctcccctgtccccattccagtcccc
cttgccagcaatgagggaccaaccatgcactgcaatgtgaccaataacagtcaccttcct
gagggtgatggtagcaacaggggggaagctgcaggccctagtggagagccacagaaccga
tag

DBGET integrated database retrieval system