KEGG   Mus musculus (mouse): 228361Help
Entry
228361            CDS       T01002                                 

Gene name
Ambra1, 2310079H06Rik, A130023A14, AA474864, AV021921, D030051N19Rik, mKIAA1736
Definition
(RefSeq) autophagy/beclin 1 regulator 1
  KO
K17985  activating molecule in BECN1-regulated autophagy protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    228361 (Ambra1)
   04137 Mitophagy - animal
    228361 (Ambra1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228361 (Ambra1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    228361 (Ambra1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    228361 (Ambra1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    228361 (Ambra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A Acyl_CoA_thio
Motif
Other DBs
NCBI-GeneID: 228361
NCBI-ProteinID: NP_766257
MGI: 2443564
Ensembl: ENSMUSG00000040506
Vega: OTTMUSG00000014330
UniProt: A2AH22
Position
2; 2 E1
AA seq 1300 aa AA seqDB search
MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTV
ECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQ
QDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEW
TRTVLTLNSRSEVESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLAT
ESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIE
SERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSS
WHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASSQEERTVGVAFNQETGHWER
IYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPA
RLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDF
EDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVL
AGAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISA
DGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVG
LASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPE
PGLGLAYGTNKGDLVICRPEALNSGIEYYWDQLSETVFTVHSSSRSSERPGTSRATWRTD
RDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEGEGSE
YGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESG
AARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQPALSSSSPVPIPVP
LASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPSGEPQNR
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtcccagagaagaatgctgtacgaatcctctggggccgagaacggggcact
cgtgccatgggtgcccagcggcttctgcaggagctggtggaggataagactcgatggatg
aaatgggagggcaagagagtagaactgcctgatagtccacgctcgaccttcttactggcc
ttcagcccagacaggactctcttggcatccacacatgtgaaccataacatctatattaca
gaggttaagactggcaagtgtgttcactctctgatcggacaccgccgtactccatggtgt
gtcacttttcaccccaccatctcaggccttattgcttctggttgcctagatggggaagtt
aggatttgggatttacatgggggcagtgaaagctggttcacagacagcaacaatgccata
gcctccttggctttccaccctacggctcagcttctactaattgccactgcaaatgagatc
catttctgggattggagtcgtcgggagccctttgctgtggtgaaaacagccagtgagatg
gagcgtgtccgcctggtgagatttgatccacttggacactacttacttacagctattgtt
aacccttctaatcagcagggtgatgacgaaccagaaatccctatagatggaacagagtta
tctcattaccgtcaacgtgccctcctgcaatcacagccagttcgccggacacctctcctc
cacaatttcctgcacatgctgtcctcccgttcctctggcatccaggtgggagagcaaagc
acagtacaagattctgctaccccctcacccccaccgcctccccctcagccctccacggag
cgtcccaggacttccgcttacatcagactccgacagcgggtcagttaccccaccacagtt
gagtgctgccagcaccctgggatcctgtgcctttgcagccgctgtgctggcactcgagtt
ccttccctcttgccacaccaggacagtgtcccccctgcttctgccagagctactacccct
tccttttcttttgtacagaccgagcccttccatcccccggagcaggcttcatcaacgcag
caggaccagggcctcctgaaccggccgtctgccttcagtacagtccagagcagcactgcg
ggcaacacgctccgcaacctcagtctgggtcctacccggcgctctttggggggccctttg
tctagccacccttctaggtatcacagagaactagcccctgggctgacaggttctgagtgg
acccggacagtactcactctgaactctcgttctgaggtagaatctatgcccccaccgagg
accagtgcctcctcagtgagtttgctttctgtactgagacagcaggaaggtggctctcag
gcatctgtgtatacttcagccacagaagggaggggttttccatcatcagggttggcaact
gagtcagatggagggaatggttccagccaaaacaactcaggcagcattcgccatgagctt
caatgtgacctgagacgcttctttttggagtatgacaggctgcaggagctggatcagagc
ctgagtggggaaactccccagacccaacaggcccaggaaatgctcaacaataatattgaa
tctgagagaccaggtccttcccacctgcctaccccacacagcagtgagaacaactccaac
ctgtctcggggccaccttaatcgatgccgtgcttgccataatcttctaaccttcaacaat
gatacccttcgttgggaaagaaccacacctaactactcatctggtgaggctagctcttcc
tggcacgtctccactacctttgagggcatgccaccaagtggcaaccagctaccacctctt
gagcggactgagggccaaatgcctagctccagcaggctggagttgagcagctctgctagt
tcacaagaggagaggactgtgggggtggcctttaaccaggagacaggccactgggaacgc
atttatacccagtccagcagatctggaactgtatcacaggaggccttacatcaagatatg
cctgaagaaagctctgaggaagactccctcaggaggaggctgctggagtcttccctcatt
tcattatcccgttatgatggagcaggatccagagagcacccaatttacccagacccagcg
agattatctcctgctgcatactacgcccagaggatgatccagtatctctcaaggagagac
agtattcgccagcgctccatgcgctaccaacagaatcggcttcgttcttccacctcctct
tcttcctcagacaaccagggtccatcagtagagggaaccgacttggaatttgaggacttt
gaggacaatggtgacagatctaggcaccgagctccccgaaatgcccgaatgtctgcacct
tcacttggacgatttgttccaaggcgttttttgctgcctgagtacttgccttatgctggg
atttttcatgaacgtggacagcctggcttggctactcattcttctgttaacagggtcctg
gcaggggcagtaattggagatggacagtctgctgtggccagtaacattgccaatactacc
tacaggctccagtggtgggacttcactaagtttgaccttccagaaatcagtaatgcctct
gtgaatgtcctggtacagaattgcaagatctacaatgatgccagctgtgacatttctgca
gatggtcagctcctggcagccttcatcccgagcagccagaggggctttcctgatgaaggc
atcctggcagtgtattccctggccccccataacttgggggaaatgctctacaccaagcga
tttggtcccaatgccatttctgtaagcctgtccccgatgggccgatacgttatggtgggc
ttggcctcacgaaggatcctactgcacccctccacagagcacatggtagcccaggtcttc
aggctgcaacaggcccatggtggtgagacttccatgaggagagttttcaatgtcctttac
cccatgcctgcagaccaacggagacacgtcagcatcaactctgcccgttggctacccgag
ccagggcttggtttggcctatggcaccaacaaaggagacttggtgatctgccgaccagag
gccttaaactctggcatcgagtactactgggaccagctaagtgaaacagtcttcactgtc
cactcaagtagcaggagcagcgagcggcctggaaccagcagagccacgtggcggacagac
agagacatgggtttgatgaatgcaattgggctgcagcctcggaacccaaccacctctgtg
acatctcagggcacccagactctggccctccagttgcagaacgctgaaacacagactgag
agggaggaagaggaaccaggggcagcatcttcaggtcctggtgaaggcgagggctcagaa
tatggtggcagtggggaagatgccctcagcaggatccagaggctgatggccgagggtggc
atgacagctgtggtacaacgggaacagagcaccaccatggcctccatgggtggctttggc
aacaacatcatcgttagccaccgcattcaccgcagctcccagacaggcacagagtcaggg
gctgctcgtacctcctcaccccagccctccacctctcgaggactgccatcagaacctggg
caactggcagagcgagcgctaagcccccggacagcctcctgggaccagcctagtacctct
gggagggaactaccccagccagccctgtcctcttcctcccctgtccccattccagtcccc
cttgccagcaatgagggaccaaccatgcactgcaatgtgaccaataacagtcaccttcct
gagggtgatggtagcaacaggggggaagctgcaggccctagtggagagccacagaaccga
tag

DBGET integrated database retrieval system